SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|334339291|ref|YP_004544271.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334339291|ref|YP_004544271.1|
Domain Number 1 Region: 49-160
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000257
Family N-acetyl transferase, NAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334339291|ref|YP_004544271.1|
Sequence length 178
Comment hypothetical protein [Desulfotomaculum ruminis DSM 2154]
Sequence
MRSEEIHTQSIILQAIIDCDYDKYKDFTCGNGSLDQFLKTEAYLSHVEKEASTTLVLADN
ELVAYFTLKHSTIRFENDKGSLEAVECLEIARIGVSIFKQNQGIGKAIVNHIIEYAYIFN
EKYIISLALRERVKWYIRNFGFQVAVEEELEADTGDPVIFIYLNLDFQKLKEELESNP
Download sequence
Identical sequences F6DTW7
WP_013840759.1.34695 gi|334339291|ref|YP_004544271.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]