SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334339398|ref|YP_004544378.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334339398|ref|YP_004544378.1|
Domain Number 1 Region: 167-407
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-60
Family Extended AAA-ATPase domain 0.00000106
Further Details:      
 
Domain Number 2 Region: 1-209
Classification Level Classification E-value
Superfamily CheY-like 7.12e-40
Family CheY-related 0.001
Further Details:      
 
Domain Number 3 Region: 380-482
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000986
Family FIS-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|334339398|ref|YP_004544378.1|
Sequence length 494
Comment sigma-54 factor interaction domain-containing protein [Desulfotomaculum ruminis DSM 2154]
Sequence
MNILLVDDDQDSRACVGNFLREMGHRVMECDSGRSALNLIASGDFSMVLSDIKMPGMSGI
ELLKNISFLPEGKKVDVVLFTGHGDMETAIEALRAGAYDYLLKPINVEELAAITERIADY
QALRRENMILTKHFEDKLKAETEETRRQLSKLKETLARSMGLGNIGFFSETMQRIAEQAN
KYHTDRSIPVLIQGETGTGKEVIAKLIHYGESWENRPFVDINCAALTPSLFESELFGYEA
GAFTGGLPKGQKGKLDLAQGGTLFLDEVAEIPLELQGKLLRVIQEKEFYRISGLKKVKVD
VRIICATNVDITKRVEQGKFREDLYYRLKVGHILIPPLRDRKEDILPLANLFLQEFSKQK
RKSFSRIGDAAAKILKGYHWPGNVRELRNAIEWVIFMYDETELKSEYLAILDRINPNHNR
EEKMEPKELNPEEFSLPEERFFLEEYMNKIVLKALKKYGGNKTKAAQYLGISRRSLYCKM
KHIRFPNKNEEIEQ
Download sequence
Identical sequences F6DV26
gi|334339398|ref|YP_004544378.1| WP_013840865.1.34695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]