SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334339789|ref|YP_004544769.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334339789|ref|YP_004544769.1|
Domain Number 1 Region: 172-360
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.14e-58
Family Methylesterase CheB, C-terminal domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 3-123
Classification Level Classification E-value
Superfamily CheY-like 9.82e-31
Family CheY-related 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|334339789|ref|YP_004544769.1|
Sequence length 361
Comment CheB methylesterase [Desulfotomaculum ruminis DSM 2154]
Sequence
MQVKVLVVDDSSLMRRLISRLLEEDKEIKVIGTAADGLEALQQIKALKPDVVSMDVEMPK
LDGIATLRRVMRECPVPIVMLSAHTHEGARATMEALSAGAVDFVPKPSKSTELPVMVADL
KTKLKVAARVSMRRVARPVLPPRSTISRETAPPAPPKVPALPIRKQRNCAKIDLVVIGCS
TGGPAALQQIIPFLPANLPAGVVVVQHIPVGFSKSMAEHLDKKSGITVRHAEEGDEVKPG
LVLVSPAGYDLSFKAKGSGTAITLSNQGAPLAPGGFRPSVDWVMKSAAEVYGCRAMGVLL
TGMGRDGAQGMLAIKQQGGPTMAEHESTCVVYGMPKAAVDLGAAQKIVPLTQMAQEIQSI
F
Download sequence
Identical sequences F6DN25
gi|334339789|ref|YP_004544769.1| WP_013841254.1.34695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]