SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334339844|ref|YP_004544824.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334339844|ref|YP_004544824.1|
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily CheY-like 1.57e-39
Family CheY-related 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334339844|ref|YP_004544824.1|
Sequence length 122
Comment response regulator receiver [Desulfotomaculum ruminis DSM 2154]
Sequence
MSKRILITDDAAFMRMMIKNILTKNGYEVVGEAENGAVAVQMYKEFKPDLVTMDITMPEM
DGIQGVKAIRSVDPNANIIMCSAMGQQTMVMEAIQAGAKDFIVKPFQQDRILQAIERVLA
RG
Download sequence
Identical sequences F6DNU3
WP_013841309.1.34695 gi|334339844|ref|YP_004544824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]