SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334340163|ref|YP_004545143.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334340163|ref|YP_004545143.1|
Domain Number 1 Region: 8-154
Classification Level Classification E-value
Superfamily CheW-like 4.05e-33
Family CheW-like 0.0012
Further Details:      
 
Domain Number 2 Region: 179-305
Classification Level Classification E-value
Superfamily CheY-like 2.99e-26
Family CheY-related 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334340163|ref|YP_004545143.1|
Sequence length 313
Comment CheW domain-containing protein [Desulfotomaculum ruminis DSM 2154]
Sequence
MDKKENSILLETGTNELQVLEFVIAGNHFGINVAKVRELVRYQEVQRIPHSQPSVEGIVW
SRDEIFTVVDLAKFMDFPASEDPSRDILIITDFNQMSVAFHVHKVDSIRRISWETVEKPS
PAIYGDREGIVTGIAKLSDRIIALIDFEKIMYEITPSSSVGAHADEAEENPGHSNSLKPI
LIAEDSPMLNKMITDVLHKAGYQNIIKTSNGQEAWDYLQGVKDKPGSVACVITDIEMPRM
DGHHLTKRIKEDRDLSKIPVVIFSSLITDVTMLKGKEVGADAQLSKPEIGQLVQTINRII
SVMKKRGEIESLC
Download sequence
Identical sequences F6DRU6
gi|334340163|ref|YP_004545143.1| WP_013841624.1.34695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]