SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334340222|ref|YP_004545202.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334340222|ref|YP_004545202.1|
Domain Number 1 Region: 596-774
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-44
Family Histidine kinase 0.00069
Further Details:      
 
Domain Number 2 Region: 1052-1171
Classification Level Classification E-value
Superfamily CheY-like 2.7e-41
Family CheY-related 0.0037
Further Details:      
 
Domain Number 3 Region: 796-907
Classification Level Classification E-value
Superfamily CheY-like 8.54e-28
Family CheY-related 0.0022
Further Details:      
 
Domain Number 4 Region: 530-608
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.92e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Domain Number 5 Region: 913-1042
Classification Level Classification E-value
Superfamily CheY-like 1.71e-19
Family CheY-related 0.0064
Further Details:      
 
Domain Number 6 Region: 150-276
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.2e-17
Family Heme-binding PAS domain 0.043
Further Details:      
 
Domain Number 7 Region: 399-520
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000195
Family N-terminal PAS domain of Pas kinase 0.096
Further Details:      
 
Domain Number 8 Region: 1150-1271
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.0000000000000824
Family Phosphorelay protein luxU 0.046
Further Details:      
 
Domain Number 9 Region: 275-391
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000611
Family Heme-binding PAS domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|334340222|ref|YP_004545202.1|
Sequence length 1276
Comment PAS sensor protein [Desulfotomaculum ruminis DSM 2154]
Sequence
MREKLIELLNQNEDRVIEKLINFAKAGGFTRFTSTRHDDWHLSVREIIQGLSTYLMKHAD
DVVNVHDAAENPACEFGVRCARMHRARGITLKMFLGLFKYYRRAYLDMVNESYLTAEEKQ
AAKKSMNTYFDRLELGFCSEWAGEGKDSRIHELQLVNRHLTNEKNKLRTIFESMTECVFV
VDPQMCITEINSAAAAYFEVQPEEVIGMTCSSLLGCDCKQEECHLYIAMNKAGCYKDVEV
EVTTKRGRRRLLTSGSFLHDISGKYAGGVQVFVDVTEKYRMEQELRLHMQANNSSSECIT
IFDESAQLIYANPEAEKMLGKGIKELLGLGIEDVYPEGERILFFLIRGNYWRGELLLKQG
LKEIIIEVHATPIRRSIGQIIGFHVAAKDITEQKAIQIKLQQAREDTEREAAKLRAIISM
MGAFIALADAEGTITEVNEKVITMTGEKKANIIGKKLWDIHQGDTLEKVQELIKKYQEQP
NQPPLTFTRIFCGHDVIMNIQPIYRDANYDGILLMVIDVTEVAESKRQAEQAREIAEKAS
QAKSEFLANMSHEIRTPMNGILGFAEVLAQQGLNQEQQESVKIIRQCGEQLMDLINDILD
LSKIESGKLILEETVFSLRKMIYETVNVIEPILMEKNVEMKISIDPHLPDYLKGDSFRIR
QILNNLLSNAAKFTHEGCVEVKVQGERTLEKTDHRNFVLTFIVSDTGIGIPSDKLAEIFE
TFTQADGSTTRKYGGTGLGLTISRSLTELMGGQLQVQSEFKKGSQFSLTLPVALVHVEKK
LAPQQRKEGSTREGVVLVIEDDWTTKQLITNYLEKAGYTVIATDHGKQALTLAKIYQPDA
IILDILLPDLSGWDILVKMKKTEEIQQIPVIVCSVLPEKERAFSLGAVDYIEKPISEEIL
ISRLEKLTLSRTSEDTHIILVDDDKTALEFLRCVIEGAGFKPHPFMLAQEALDFIFRHEP
VHAVILDLLMPGMDGFDFLDHLRSNPKFKSLPVLINTGKDLTQQDYQKLNDKYERILNKS
YIHPEALLRELNLLIRDGVQRKPVNQKMKKGPVNVLLVEDNSFNQKLIEHLLTGDGYKVT
MVENGQEALAALDQGEYDIVLMDMQMPVMDGYEATRQIRNMEKYKKLPVIALTAHAMKGD
CEKCLSAGCDDYLAKPVNKDMLIKTIKKFTDSPAEESRGKKTRIRDKGIELLVPWYLQDL
AGEMDKLKEAARINDLVTVRYISHGLKGSGGAYGFPELSNLGAEIERAAVNQDLELVRSL
VNQLRELYTEILEEEL
Download sequence
Identical sequences F6DSD7
WP_013841683.1.34695 gi|334340222|ref|YP_004545202.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]