SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334340579|ref|YP_004545559.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334340579|ref|YP_004545559.1|
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily CheY-like 6.26e-28
Family CheY-related 0.0068
Further Details:      
 
Domain Number 2 Region: 135-204
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000000201
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334340579|ref|YP_004545559.1|
Sequence length 204
Comment response regulator receiver [Desulfotomaculum ruminis DSM 2154]
Sequence
MMKKIRIMLIEDHNVFREGLKKLLELEENMAVVAEAGSCREALDILTKDIDVILLDIGLP
DGDGIELAGKIKEKYPHIKHVALTTYDDAIFIKKAMECGIKGFVPKYAFFEEIRAAVLMT
HRGGTYLYPGLSTNTLLNLADPGLSETDLHILQLLASGKNQKEIAGSLFISLSTFRRRLR
DILAKLNVSSVEEALTTAVKKGLI
Download sequence
Identical sequences F6DVC0
gi|334340579|ref|YP_004545559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]