SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334340777|ref|YP_004545757.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334340777|ref|YP_004545757.1|
Domain Number 1 Region: 53-133
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000709
Family N-acetyl transferase, NAT 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334340777|ref|YP_004545757.1|
Sequence length 150
Comment hypothetical protein [Desulfotomaculum ruminis DSM 2154]
Sequence
MHYLPAPDPNLDIFRLRLERLLQTRLCFIEHILFPRCVYITDADHNNDIEEENFYLIYEL
KKDPMGLSQAYIHFFQIPFHLRNKGMGRQIYQLFEEVVRNQGCKSIALEARVNSSNPKDN
TVGFWGRQGFFSYVSYAFDDENYPMIKRFV
Download sequence
Identical sequences F6DLC3
gi|334340777|ref|YP_004545757.1| WP_013842230.1.34695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]