SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334341286|ref|YP_004546266.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334341286|ref|YP_004546266.1|
Domain Number 1 Region: 490-659
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.06e-43
Family Histidine kinase 0.00087
Further Details:      
 
Domain Number 2 Region: 691-827
Classification Level Classification E-value
Superfamily CheY-like 8.4e-37
Family CheY-related 0.00096
Further Details:      
 
Domain Number 3 Region: 879-1017
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.94e-18
Family Histidine kinase 0.016
Further Details:      
 
Domain Number 4 Region: 421-502
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000196
Family Homodimeric domain of signal transducing histidine kinase 0.0021
Further Details:      
 
Domain Number 5 Region: 55-194
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000156
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|334341286|ref|YP_004546266.1|
Sequence length 1033
Comment ATP-binding protein [Desulfotomaculum ruminis DSM 2154]
Sequence
MTKRTIYSFLSVVFSLAIALGLLFFALERDGSNEPRAVKGVLDAREYDFDAEGPLQLNGE
WQFVAGKLADTAYFDQHQDIPHYVPVPSEWTRYETDGRPMPPYGSATYRLRVQLPEMNGV
MGVKTNNIRMSNAVWINGEKVGQSGIPQENASYQARNTPYVAFFPLEGNELEIIVQAANF
HYGTGGGIISSLYLGDEQSILRTLDLQRMYDWVMLVSFLTMGIYFFNFYFFLRKYRELLF
FSLACFMFALYTATHGEKLLHAYYPQLPYILFLGLQRLSGVLMGIFLSLFFHFLFPRLSH
QKILYAVLLIGGLILVLICSPARFNMGAQVEVLKLNILFPLAVVIHIFYIQVKTVQAGVA
GASFLMVASSVTILYIAVGILNVYNQMNPSILPPLIPFIYMLLLSLYMSNRFVSIYKQNE
ALSERLVQADRFKDEFLAKTSHEFRTPLHGVMTLVQSMLTSPASGSLTPEQTNKLSLVKE
ISKRLAFLVEDIADLSKLKQGQLKIRPQNVDLHTISHLVTEVFAHVLPGHMTLRNQVSPH
IPYVRADENRLRQILNNLIDNAAKHAGAGGEIELSAQEQAGFVVVSVKDAGPGIAPEELE
KVFEPYQQGAIPSQRPGGVGLGLAIARQLVELQGGRIWVQSEQGKGAVFSFTIPVAATEK
VRPIDISLQETADFRTAPVSFPMSRMVEKGHGKKIIIADDDHTSLRVLMEALEPEGYFLI
AVDNGQAVLDLLEQRADVDLIILDIMMPGLSGYEVCRKIRASYSIAELPVLMLTAAILPE
DMVAAFQSGANDFLHKPFDLTELKSRMSSLLNLKEAVATASRMEAAFLQAQIRPHFLYNV
LNSILSLSYMDIEKTRKLITEFANFLRGSFAFSNTSQFVPLEKELALIQSYITIEEARFP
GRFQFELAVEKNLRCYLPPLLLQPLVENAVRHGLANRQEGTVSLTARRDGNGVIFQIRDN
GAGMSKAQVESIRQQQPLPGGGVGLLNLCKRIKQHPGFSVAIRSEENMGTSIVITAPYRD
RFSEKETAAREEA
Download sequence
Identical sequences F6DRV6
gi|334341286|ref|YP_004546266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]