SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334341642|ref|YP_004546622.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334341642|ref|YP_004546622.1|
Domain Number 1 Region: 751-900
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-35
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 429-536
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-26
Family Flavin-binding PAS domain 0.024
Further Details:      
 
Domain Number 3 Region: 533-652
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.39e-22
Family Heme-binding PAS domain 0.0058
Further Details:      
 
Domain Number 4 Region: 131-248
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.19e-22
Family Heme-binding PAS domain 0.0017
Further Details:      
 
Domain Number 5 Region: 3-156
Classification Level Classification E-value
Superfamily CheY-like 4.55e-21
Family CheY-related 0.0029
Further Details:      
 
Domain Number 6 Region: 252-416
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-18
Family GAF domain 0.0099
Further Details:      
 
Domain Number 7 Region: 671-744
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000726
Family Homodimeric domain of signal transducing histidine kinase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334341642|ref|YP_004546622.1|
Sequence length 916
Comment PAS sensor protein [Desulfotomaculum ruminis DSM 2154]
Sequence
MNGILIMDNQPRSRLTVKSMFEAGGFPVNILEAADGDAAVQILKKQQVDCVLIDYLLFKE
NKHLILKSLQEQRVEIPVIMLTEGRDEPPAVEMMKSGAADYLAKDRLSPEILIRAVRHAI
QISQAEARAEMAREAQRKTEAYTRTIIENIPDAIITIDGLGIINSFNPAAERMFGYPKHQ
MVGQNILLLMEGHLARDISLRSYLTKEGTVTESFGKRKDGGIFPIEISVSAMKIGDNSRF
IFIIRDISPRKRMERRDAVLHQAALMVLEEKPVNEIVQFISQQLIDLFAIDGGWIGLKEP
QGTVRVIARAGEILPCINEISLRWDDVSGEHGPCTLAIRTGQMQVMQRGNVLSGFCRQQA
GVHRVRSIAAFPLAIRGQVLGVLVLCSRKKFFFNPGLITQLDNFSGQVAIALHAASARQH
LLLLTTALEAADNAVVISDREGIIQWFNPSFLRLTGYSAGEALGQKTSLLKSGKQDRFFY
QELWKKILAGKVWHGEIVNRHKSSNHYTEEMTITPVRDERGEIVNFIAIKQDVTERKKAE
EILQRYQLLSERVNDIILMADSHGRLIEANGAAERAYGYRREELLSLHLADLRDPETLAV
YKDQLKQAVARGALFETSHRRKDGSTFPVEVSSLGAVIGGKQVILSIIRNITARKKAEAE
MLEARQQLMRAERMASLGTMSAGIAHEINQPLNSLKVMVDGMLYWYKRGRMPSMDKMMDN
LEKISQQTLRIENIIRNMRSLVRSKNMSGLLPCNVNRAVEGALAMVKDELSTHKIKVIKN
LQMDLPPICGQETRVEEIILNLLINAIQALDAVKLQKKEISCATWQEQHRVILEIRDTGP
GISQEISPKIFEPFYTTKPVGEGMGLGLSIVHSIVNSLNGHIYLASSPKGGAAFRVEFPL
FSLRESNEEYEPVGTI
Download sequence
Identical sequences F6DUF1
WP_013843087.1.34695 gi|334341642|ref|YP_004546622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]