SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|334341805|ref|YP_004546785.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334341805|ref|YP_004546785.1|
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily CheY-like 4.98e-38
Family CheY-related 0.00017
Further Details:      
 
Domain Number 2 Region: 125-227
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.3e-30
Family PhoB-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334341805|ref|YP_004546785.1|
Sequence length 228
Comment response regulator receiver [Desulfotomaculum ruminis DSM 2154]
Sequence
MKRILIIEDDLDIAELERDYLQLNGFKSEIVQDGLQGLKKAVSGLYDVVVVDLMLPNKDG
YEIIREVRKKLEIPVLVVSAKGEEIDKIRGLDIGADDYLTKPFSPAELVARIKSHIRRYE
RLKGPTLASELLQYKGLEINTASHKVFVNDKEVQLTAKEYDLLVFLAANPNIVFTKEHLF
DTLWGSEYCGDTATVAVHIQKIRKKIEKDPANPEFIETLWGTGYRFNS
Download sequence
Identical sequences F6DK82
gi|334341805|ref|YP_004546785.1| WP_013843245.1.34695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]