SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334339652|ref|YP_004544632.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|334339652|ref|YP_004544632.1|
Domain Number - Region: 95-122
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0239
Family HSP33 redox switch-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|334339652|ref|YP_004544632.1|
Sequence length 123
Comment hypothetical protein [Desulfotomaculum ruminis DSM 2154]
Sequence
MAKIYPFPNQAARALIHSVIQLYAAGKWTRQQMMDRIHQTMKQYGCTTLHFENFTVRITE
PVVTSMGQFNVAIIESHSISSRLGCPVCYSAEAGYLAGDKVITVACRDCGCIYRFREKEV
KKG
Download sequence
Identical sequences F6DM04
WP_013841117.1.34695 gi|334339652|ref|YP_004544632.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]