SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|334340261|ref|YP_004545241.1| from Desulfotomaculum ruminis DSM 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334340261|ref|YP_004545241.1|
Domain Number 1 Region: 96-229
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 6.8e-28
Family GntR ligand-binding domain-like 0.0087
Further Details:      
 
Domain Number 2 Region: 9-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.16e-20
Family GntR-like transcriptional regulators 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|334340261|ref|YP_004545241.1|
Sequence length 239
Comment GntR family transcriptional regulator [Desulfotomaculum ruminis DSM 2154]
Sequence
MFNNKIGRSDTLRNEVAGYIKTLISSGQLKPGDRLPTERVMSENFGVSRTVIRDAVKTLA
GIGLLEVKHGVGIFVATVDGALVGRQLSNLLTYHLDTIEHIYEVRILLEKFAAQWAAERC
TQEDYEKIKDLLEEAHTVNPIEYGDRFADLNRKFHLLIAEASQNPVIAMMVENILDLLEN
VSDETHTIPGRANLSIEQHEKVLELIIQHKPQEAKRAMEEHLSSVLTTLKKKNNPNTVL
Download sequence
Identical sequences F6DSW1
gi|334340261|ref|YP_004545241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]