SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384414108|ref|YP_005623470.1| from Yersinia pestis biovar Medievalis str. Harbin 35

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384414108|ref|YP_005623470.1|
Domain Number 1 Region: 219-693
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.2e-78
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0011
Further Details:      
 
Domain Number 2 Region: 81-213
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.44e-34
Family Ferredoxin domains from multidomain proteins 0.00053
Further Details:      
 
Domain Number 3 Region: 1-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.86e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.037
Further Details:      
 
Domain Number 4 Region: 821-896
Classification Level Classification E-value
Superfamily ADC-like 0.0000000000000746
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384414108|ref|YP_005623470.1|
Sequence length 914
Comment NADH:ubiquinone oxidoreductase subunit G [Yersinia pestis biovar Medievalis str. Harbin 35]
Sequence
MATIHVDGKEYDVNGADNLLQACLSLGLDIPYFCWHPALGSVGACRQCAVKQYQNADDTR
GRLVMSCMTPATDGTFISIDDSEAKAFRESVVEWLMTNHPHDCPVCEEGGNCHLQDMTVM
TGHSFRRYRFTKRTHQNQDLGPFISHEMNRCIACYRCVRYYKDYADGTDLGVYGAHDNVY
FGRTESGTLESEFSGNLVEVCPTGVFTDKTHSERYNRKWDMQFAPSICQQCSVGCNTSPG
ERYGELRRIENRYNGSVNHYFMCDRGRFGYGYVNLKDRPRQPQQLRGSDWIHLNADQVMQ
GAADILRQAKKTIGIGSPRASLESNFALRELVGAENFYTGIAAGEQQRLQLMLKVLREGG
IYTPALREIESYDAVLILGEDLTQTGARIALSVRQAVKGKAREMAAAQKVADWQIAAIMN
IGQHAKHPLFITNVDNTRMDDIAAWNYRAPVDDQARLGFAIAHALDESAPAVADLDRSLK
GKVDIIVQALAGAKKPLIITGSSAGSDAIIEAAANVAKALKNRGSDVGITFVASAANSIG
LSMIGGGSLDQALELLTRGEADSAIVMENDLYRHAAKDKVDAALDNVANLIVVDHQRTAI
MDKANLILSAASFAESDGTLVNQEGRAQRFFQVYDPTYYDDPKKPESRSIMLESWRWLHS
LHSTYTSRHVDWTQLDHVIAACVEALPQLQGIVEAAPDATFRIRGQRLARSPHRYSGRTA
MRADISVHEPRQPQDIDTPFSFSMEGNNSPLADRQQIPFAWAPGWNSPQAWNKFQAEVGG
SLRFGDPGVRLIEAGEGTLDYFDSIPAAFTATAGNWQIAPYYHLFGSEEMSQRSDVIQQR
MPTPYVMVNPADAAALGVNLGTLVEFNCAGQTLRLPVRLSDTLAPGQVGLPLGLPGIPPI
LVGARVEDLREAVQ
Download sequence
Identical sequences A0A0E1NUB5 A0A0H2YIY9 A0A0M1V8J9 A0A208S512 Q8ZDL2
WP_002210275.1.100246 WP_002210275.1.100921 WP_002210275.1.100931 WP_002210275.1.10105 WP_002210275.1.101382 WP_002210275.1.101928 WP_002210275.1.102012 WP_002210275.1.102067 WP_002210275.1.10736 WP_002210275.1.10935 WP_002210275.1.10955 WP_002210275.1.11693 WP_002210275.1.12463 WP_002210275.1.12736 WP_002210275.1.12857 WP_002210275.1.1388 WP_002210275.1.14063 WP_002210275.1.15321 WP_002210275.1.15555 WP_002210275.1.15605 WP_002210275.1.15689 WP_002210275.1.16243 WP_002210275.1.16333 WP_002210275.1.17135 WP_002210275.1.17141 WP_002210275.1.17608 WP_002210275.1.17873 WP_002210275.1.17983 WP_002210275.1.18208 WP_002210275.1.18826 WP_002210275.1.19425 WP_002210275.1.19739 WP_002210275.1.20035 WP_002210275.1.2064 WP_002210275.1.21486 WP_002210275.1.21784 WP_002210275.1.21879 WP_002210275.1.21934 WP_002210275.1.22530 WP_002210275.1.22542 WP_002210275.1.22708 WP_002210275.1.23157 WP_002210275.1.23271 WP_002210275.1.23687 WP_002210275.1.23811 WP_002210275.1.24002 WP_002210275.1.2451 WP_002210275.1.25181 WP_002210275.1.25394 WP_002210275.1.2640 WP_002210275.1.26776 WP_002210275.1.26960 WP_002210275.1.27124 WP_002210275.1.27251 WP_002210275.1.2726 WP_002210275.1.28647 WP_002210275.1.28922 WP_002210275.1.29157 WP_002210275.1.29355 WP_002210275.1.2947 WP_002210275.1.29622 WP_002210275.1.2964 WP_002210275.1.29685 WP_002210275.1.29814 WP_002210275.1.3092 WP_002210275.1.30931 WP_002210275.1.311 WP_002210275.1.31496 WP_002210275.1.31739 WP_002210275.1.31805 WP_002210275.1.32343 WP_002210275.1.32446 WP_002210275.1.33661 WP_002210275.1.33937 WP_002210275.1.34031 WP_002210275.1.34138 WP_002210275.1.35389 WP_002210275.1.35538 WP_002210275.1.36088 WP_002210275.1.37174 WP_002210275.1.37494 WP_002210275.1.37863 WP_002210275.1.38147 WP_002210275.1.38235 WP_002210275.1.38743 WP_002210275.1.39066 WP_002210275.1.39346 WP_002210275.1.3976 WP_002210275.1.40071 WP_002210275.1.40134 WP_002210275.1.40853 WP_002210275.1.4210 WP_002210275.1.42490 WP_002210275.1.44408 WP_002210275.1.44603 WP_002210275.1.44832 WP_002210275.1.45198 WP_002210275.1.45214 WP_002210275.1.46262 WP_002210275.1.46545 WP_002210275.1.46686 WP_002210275.1.46731 WP_002210275.1.4678 WP_002210275.1.46891 WP_002210275.1.47387 WP_002210275.1.47440 WP_002210275.1.48166 WP_002210275.1.48722 WP_002210275.1.4889 WP_002210275.1.49906 WP_002210275.1.4997 WP_002210275.1.50010 WP_002210275.1.50093 WP_002210275.1.50106 WP_002210275.1.50984 WP_002210275.1.51284 WP_002210275.1.51293 WP_002210275.1.51588 WP_002210275.1.51772 WP_002210275.1.51934 WP_002210275.1.52158 WP_002210275.1.52247 WP_002210275.1.52734 WP_002210275.1.52819 WP_002210275.1.52969 WP_002210275.1.53300 WP_002210275.1.53838 WP_002210275.1.53848 WP_002210275.1.53953 WP_002210275.1.54568 WP_002210275.1.54951 WP_002210275.1.55194 WP_002210275.1.55695 WP_002210275.1.5592 WP_002210275.1.56031 WP_002210275.1.56912 WP_002210275.1.56953 WP_002210275.1.57585 WP_002210275.1.57657 WP_002210275.1.58067 WP_002210275.1.58794 WP_002210275.1.59102 WP_002210275.1.59431 WP_002210275.1.5957 WP_002210275.1.59635 WP_002210275.1.59687 WP_002210275.1.59789 WP_002210275.1.59885 WP_002210275.1.60437 WP_002210275.1.60707 WP_002210275.1.60896 WP_002210275.1.61689 WP_002210275.1.62232 WP_002210275.1.62342 WP_002210275.1.6270 WP_002210275.1.63387 WP_002210275.1.64142 WP_002210275.1.64474 WP_002210275.1.64780 WP_002210275.1.64786 WP_002210275.1.64910 WP_002210275.1.653 WP_002210275.1.65400 WP_002210275.1.65554 WP_002210275.1.6570 WP_002210275.1.65718 WP_002210275.1.6581 WP_002210275.1.66118 WP_002210275.1.66546 WP_002210275.1.66616 WP_002210275.1.67404 WP_002210275.1.67850 WP_002210275.1.68361 WP_002210275.1.68753 WP_002210275.1.68855 WP_002210275.1.69018 WP_002210275.1.69316 WP_002210275.1.69951 WP_002210275.1.70117 WP_002210275.1.70171 WP_002210275.1.70319 WP_002210275.1.70377 WP_002210275.1.70726 WP_002210275.1.7083 WP_002210275.1.7169 WP_002210275.1.71744 WP_002210275.1.72440 WP_002210275.1.72486 WP_002210275.1.7402 WP_002210275.1.74131 WP_002210275.1.74310 WP_002210275.1.74577 WP_002210275.1.74738 WP_002210275.1.75173 WP_002210275.1.7518 WP_002210275.1.75337 WP_002210275.1.75407 WP_002210275.1.75636 WP_002210275.1.75821 WP_002210275.1.76670 WP_002210275.1.77387 WP_002210275.1.77429 WP_002210275.1.78004 WP_002210275.1.7841 WP_002210275.1.78556 WP_002210275.1.79515 WP_002210275.1.79550 WP_002210275.1.79609 WP_002210275.1.79981 WP_002210275.1.8009 WP_002210275.1.80331 WP_002210275.1.81848 WP_002210275.1.81877 WP_002210275.1.8210 WP_002210275.1.82133 WP_002210275.1.82151 WP_002210275.1.82270 WP_002210275.1.82619 WP_002210275.1.8303 WP_002210275.1.83039 WP_002210275.1.83265 WP_002210275.1.8420 WP_002210275.1.84703 WP_002210275.1.84720 WP_002210275.1.85269 WP_002210275.1.85270 WP_002210275.1.8559 WP_002210275.1.85802 WP_002210275.1.86034 WP_002210275.1.86413 WP_002210275.1.87107 WP_002210275.1.8728 WP_002210275.1.87418 WP_002210275.1.8762 WP_002210275.1.87853 WP_002210275.1.87988 WP_002210275.1.88362 WP_002210275.1.88472 WP_002210275.1.89359 WP_002210275.1.8964 WP_002210275.1.90624 WP_002210275.1.91373 WP_002210275.1.91844 WP_002210275.1.92030 WP_002210275.1.92331 WP_002210275.1.927 WP_002210275.1.9311 WP_002210275.1.9320 WP_002210275.1.93623 WP_002210275.1.93928 WP_002210275.1.93933 WP_002210275.1.94052 WP_002210275.1.94201 WP_002210275.1.94545 WP_002210275.1.94683 WP_002210275.1.95746 WP_002210275.1.95981 WP_002210275.1.97245 WP_002210275.1.97375 WP_002210275.1.97448 WP_002210275.1.97791 WP_002210275.1.97864 WP_002210275.1.97872 WP_002210275.1.97894 WP_002210275.1.99109 WP_002210275.1.99383 WP_002210275.1.9941 WP_002210275.1.99416 WP_002210275.1.99788 WP_002210275.1.99990 YP_002347511.1.25044 gi|384126612|ref|YP_005509226.1| gi|162420721|ref|YP_001606300.1| gi|45442150|ref|NP_993689.1| 187410.y1635 214092.YPO2550 229193.YP_2361 349746.YpAngola_A1811 360102.YPA_2042 377628.YPN_2145 386656.YPDSF_1960 gi|384414108|ref|YP_005623470.1| gi|145599240|ref|YP_001163316.1| gi|22125530|ref|NP_668953.1| gi|384123051|ref|YP_005505671.1| gi|218929636|ref|YP_002347511.1| gi|294504364|ref|YP_003568426.1| gi|384139620|ref|YP_005522322.1| gi|108808037|ref|YP_651953.1| gi|108812307|ref|YP_648074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]