SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384415096|ref|YP_005624458.1| from Yersinia pestis biovar Medievalis str. Harbin 35

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384415096|ref|YP_005624458.1|
Domain Number 1 Region: 56-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.25e-118
Family Pyridoxal-dependent decarboxylase 0.0000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384415096|ref|YP_005624458.1|
Sequence length 515
Comment putative decarboxylase [Yersinia pestis biovar Medievalis str. Harbin 35]
Sequence
MYKDIYEENHFIDQGNDITDVLCLENFLNKDSAEHYYENVNNITARIKAVFTLVDKPFSG
VLPSELSPDFYCIDLNQPLTSLDSALDELQQLYIKDAIYFHHPKYVAHLNCPVVLPAVLA
ESIISTLNSSLDTWDQSAGATLIEQKVLDWTRDKMALGSQGDGIFTSGGTQSNLMAILLA
RDHFCHQRDANHQNKLQGLPADSHKFRIFTSVVSHFSTQKAAALLGLGYNAVVAVPYDSE
FKMDAQALDQSIALCLSQGNIPLAIVATTGTTDFGSIDPLHTISTLAKQYGLWLHVDAAY
GCGLLVSSHYEQLLSGIEMADSVTVDYHKSFFQPVSCSAFFVKDKQHFSYLTYHAEYLNP
LSASLEGTPNLVNKSIQTTRRFDALKLWLTLRIMGAKQLGLAFEHVMDTAQQAYQLMLPN
PYFELIHRPVLSTLVFRFMPEQPRSDDDIDRTNAYIRKALFREGHTVIAGTKVNGKQYLK
FTFLNPTTTLQHLNEIVDAIITEGKNYPTLYNSQS
Download sequence
Identical sequences A0A0E1NT17 A0A0H2YJT9 A0A0M1V329 A0A208S3E2 Q0WGP3 Q7CHR5
187410.y2641 214092.YPO1529 229193.YP_1418 349746.YpAngola_A3190 360102.YPA_0823 377628.YPN_2451 gi|162418852|ref|YP_001607546.1| gi|384121951|ref|YP_005504571.1| gi|294503504|ref|YP_003567566.1| gi|22126520|ref|NP_669943.1| gi|108806820|ref|YP_650736.1| gi|384415096|ref|YP_005624458.1| gi|384140587|ref|YP_005523289.1| WP_002211877.1.100083 WP_002211877.1.100246 WP_002211877.1.100921 WP_002211877.1.10105 WP_002211877.1.101928 WP_002211877.1.102012 WP_002211877.1.102067 WP_002211877.1.10736 WP_002211877.1.10935 WP_002211877.1.10955 WP_002211877.1.11693 WP_002211877.1.12463 WP_002211877.1.12857 WP_002211877.1.14804 WP_002211877.1.15321 WP_002211877.1.15555 WP_002211877.1.16333 WP_002211877.1.17141 WP_002211877.1.17983 WP_002211877.1.18208 WP_002211877.1.18640 WP_002211877.1.18826 WP_002211877.1.19329 WP_002211877.1.19425 WP_002211877.1.19739 WP_002211877.1.19763 WP_002211877.1.2064 WP_002211877.1.21784 WP_002211877.1.21879 WP_002211877.1.23157 WP_002211877.1.23271 WP_002211877.1.23811 WP_002211877.1.24002 WP_002211877.1.2451 WP_002211877.1.2640 WP_002211877.1.26960 WP_002211877.1.27124 WP_002211877.1.27251 WP_002211877.1.2726 WP_002211877.1.28647 WP_002211877.1.29157 WP_002211877.1.29355 WP_002211877.1.2947 WP_002211877.1.2964 WP_002211877.1.29814 WP_002211877.1.3092 WP_002211877.1.30931 WP_002211877.1.311 WP_002211877.1.31336 WP_002211877.1.31496 WP_002211877.1.31739 WP_002211877.1.31805 WP_002211877.1.32343 WP_002211877.1.32388 WP_002211877.1.32446 WP_002211877.1.33203 WP_002211877.1.33937 WP_002211877.1.34138 WP_002211877.1.35389 WP_002211877.1.35538 WP_002211877.1.36088 WP_002211877.1.37174 WP_002211877.1.37863 WP_002211877.1.38235 WP_002211877.1.38824 WP_002211877.1.38993 WP_002211877.1.39066 WP_002211877.1.39346 WP_002211877.1.40071 WP_002211877.1.40134 WP_002211877.1.40534 WP_002211877.1.40853 WP_002211877.1.4210 WP_002211877.1.42490 WP_002211877.1.44832 WP_002211877.1.45198 WP_002211877.1.45214 WP_002211877.1.46262 WP_002211877.1.46545 WP_002211877.1.4678 WP_002211877.1.46891 WP_002211877.1.47387 WP_002211877.1.47440 WP_002211877.1.48166 WP_002211877.1.48722 WP_002211877.1.4997 WP_002211877.1.50010 WP_002211877.1.50093 WP_002211877.1.50984 WP_002211877.1.51284 WP_002211877.1.51293 WP_002211877.1.51588 WP_002211877.1.51772 WP_002211877.1.51934 WP_002211877.1.52158 WP_002211877.1.52247 WP_002211877.1.52734 WP_002211877.1.52819 WP_002211877.1.53838 WP_002211877.1.53848 WP_002211877.1.53953 WP_002211877.1.54951 WP_002211877.1.55695 WP_002211877.1.5592 WP_002211877.1.56031 WP_002211877.1.56912 WP_002211877.1.57585 WP_002211877.1.57657 WP_002211877.1.58067 WP_002211877.1.59102 WP_002211877.1.59431 WP_002211877.1.5957 WP_002211877.1.59635 WP_002211877.1.59687 WP_002211877.1.59789 WP_002211877.1.59885 WP_002211877.1.60437 WP_002211877.1.62232 WP_002211877.1.62342 WP_002211877.1.6270 WP_002211877.1.63387 WP_002211877.1.64142 WP_002211877.1.64474 WP_002211877.1.64780 WP_002211877.1.64786 WP_002211877.1.64910 WP_002211877.1.653 WP_002211877.1.65554 WP_002211877.1.6570 WP_002211877.1.65706 WP_002211877.1.65718 WP_002211877.1.66118 WP_002211877.1.66546 WP_002211877.1.66616 WP_002211877.1.67404 WP_002211877.1.67850 WP_002211877.1.68361 WP_002211877.1.68753 WP_002211877.1.69018 WP_002211877.1.69316 WP_002211877.1.70117 WP_002211877.1.70171 WP_002211877.1.70319 WP_002211877.1.70377 WP_002211877.1.70417 WP_002211877.1.70726 WP_002211877.1.7083 WP_002211877.1.7169 WP_002211877.1.71744 WP_002211877.1.72280 WP_002211877.1.72440 WP_002211877.1.7402 WP_002211877.1.74131 WP_002211877.1.74310 WP_002211877.1.74577 WP_002211877.1.74738 WP_002211877.1.7518 WP_002211877.1.75337 WP_002211877.1.75689 WP_002211877.1.75821 WP_002211877.1.76670 WP_002211877.1.77387 WP_002211877.1.77429 WP_002211877.1.77691 WP_002211877.1.78004 WP_002211877.1.7841 WP_002211877.1.78556 WP_002211877.1.79515 WP_002211877.1.79550 WP_002211877.1.79981 WP_002211877.1.80331 WP_002211877.1.81848 WP_002211877.1.81877 WP_002211877.1.8210 WP_002211877.1.82133 WP_002211877.1.82151 WP_002211877.1.82270 WP_002211877.1.82619 WP_002211877.1.8303 WP_002211877.1.83039 WP_002211877.1.83265 WP_002211877.1.8420 WP_002211877.1.84703 WP_002211877.1.85269 WP_002211877.1.85270 WP_002211877.1.8559 WP_002211877.1.85802 WP_002211877.1.86034 WP_002211877.1.86413 WP_002211877.1.87107 WP_002211877.1.87418 WP_002211877.1.87853 WP_002211877.1.87988 WP_002211877.1.88362 WP_002211877.1.88472 WP_002211877.1.89359 WP_002211877.1.8964 WP_002211877.1.90176 WP_002211877.1.9051 WP_002211877.1.91373 WP_002211877.1.92331 WP_002211877.1.92604 WP_002211877.1.9311 WP_002211877.1.9320 WP_002211877.1.93623 WP_002211877.1.93928 WP_002211877.1.94052 WP_002211877.1.94201 WP_002211877.1.94683 WP_002211877.1.97375 WP_002211877.1.97791 WP_002211877.1.97894 WP_002211877.1.99109 WP_002211877.1.99383 WP_002211877.1.99788 WP_002211877.1.99990 YP_002346545.1.25044 gi|108812612|ref|YP_648379.1| gi|218928670|ref|YP_002346545.1| gi|384126050|ref|YP_005508664.1| gi|45441243|ref|NP_992782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]