SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312136434|ref|YP_004003771.1| from Methanothermus fervidus DSM 2088

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312136434|ref|YP_004003771.1|
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.66e-18
Family GHMP Kinase, N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 222-317
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000345
Family Homoserine kinase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312136434|ref|YP_004003771.1|
Sequence length 324
Comment beta-ribofuranosylaminobenzene 5'-phosphate synthase [Methanothermus fervidus DSM 2088]
Sequence
MEVKTPSRLHITLIDLNGKIGRIDGGIGITLKKPSIVIKGEPAERSKIEFSGKVYSEKEY
INKIKMATEKTLDYFDENTNFEFNVKKTYPAHAGLGSGTQTALATAKIISHYLGYECDAR
SLAKIVGRGGTSGIGVAAFENGGFIVDGGHSTSEKKDFLPSSASKASPPPILVNYNFPKD
WKIIVAMPYSGRSISGNKEVNIFKKYCPIPLRDVEKICHIILMKMLPALIEKDIEEFGDC
INKIQNLGFKKIERELQSKYVDKIIENMKSAGAVCAGMSSFGPTVYGITDSNAKDIANAA
REVIGDEGEVIITNAQNKGAEIKK
Download sequence
Identical sequences E3GXH7
WP_013413287.1.12012 gi|312136434|ref|YP_004003771.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]