SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312137118|ref|YP_004004455.1| from Methanothermus fervidus DSM 2088

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312137118|ref|YP_004004455.1|
Domain Number 1 Region: 5-192
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.92e-36
Family GHMP Kinase, N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 176-315
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.91e-30
Family Mevalonate kinase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|312137118|ref|YP_004004455.1|
Sequence length 316
Comment mevalonate kinase [Methanothermus fervidus DSM 2088]
Sequence
MHSVASAPNKIILFGEHAVVYKKPAIAVAINKRAKVSIKNTKKDSTIIKCNDIGLHANIN
PKTYNIEFLEGKKGILNYILEVLKSHHDNSPIKIDISLEVPLGIGLGSSAAITVALIAAL
HNYHEKVIDKSSLSKKAHEIELKVQGAASPLDTAVSTYGGMIYLKDSNIEYIKPNIEGSF
IVAYTPKPADTKKMVSLVKKKLEKYPNIVGNIIDTIGNVTKTAYELIKEGKFEKIGELMN
INHGLLDSIGVSSSELSQMVYSARNAGALGSKITGAGGSGSIIAYCINNEDKVLNTLKSQ
WDAFKTKFSKDGVIIH
Download sequence
Identical sequences E3GZG1
gi|312137118|ref|YP_004004455.1| WP_013413971.1.12012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]