SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322435037|ref|YP_004217249.1| from Granulicella tundricola MP5ACTX9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322435037|ref|YP_004217249.1|
Domain Number 1 Region: 575-900
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.96e-123
Family Methionine synthase SAM-binding domain 0.0000000177
Further Details:      
 
Domain Number 2 Region: 25-299
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 3.14e-89
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0017
Further Details:      
 
Domain Number 3 Region: 420-568
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 3.4e-43
Family Cobalamin (vitamin B12)-binding domain 0.00000127
Further Details:      
 
Domain Number 4 Region: 321-407
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.2e-25
Family Methionine synthase domain 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|322435037|ref|YP_004217249.1|
Sequence length 902
Comment methionine synthase [Granulicella tundricola MP5ACTX9]
Sequence
MSETVAPKPLRLSGSQPFTQQAGVFIMLGERTNVAGSPKFAKLIKEGKYEEAVSVARQQV
ENGANVIDICMDEGMIDGVAAMTRFLQLLASEPEVAKVPFMVDSSKWEVIEAGLKTLQGK
GIVNSISLKEGEDKFRQNAARVLKYGAAVVVMAFDEQGQAATYEEKIRICERAYRILVDE
VGFPPEDIIFDPNILTVATGMEEHNNYAVDFINATRWIKANLPHAKVSGGVSNISFSFRG
NNKVREAMHSAFLYHAIAAGLDMGIVNAGMLELYEEIEPELKVLVEDVLLNRRPDATERL
VEHGEKLKNVGTVVTAKQAEEWRSGTVEERLSHALVRGIDAYIELDTEEARVKLGRPLLV
IEGPLMDGMGVVGDLFGAGKMFLPQVVKSARVMKKAVAHLTPFMEAEKAAMEAAGEVVKA
QGKILLATVKGDVHDIGKNIVGVVLACNNYEVIDMGVMVSSEKILTRAKEEKVDLIGLSG
LITPSLDEMVHVAKEMERQGFTQPLLIGGATTSRAHTAVKIAPHYSQPVVHVLDASRAVP
VTTSLLSDDGKADFVTRHNADYEALRKAHAAPRQQTVPLATARARHTPIEWRKEDLAVPA
FTGVRVLDNFPLATLRDYIDWTPFFHAWGLKGIYPRILDHGDHGEHARQVLTEGRALLDR
IINENLVTARGVYGFFPANAVGDDVTLYTDETRSASRETFHFLRQQANREGSEPCRSLSD
FIAPQETGLADYIGGFAVTTGLGLKALTDSFRAANDDYNAIMAEALVDRLAEAFAECLHK
RVRDEWGYGCDEGLTPEELIHEKYRGIRPAAGYPACPDHTEKGTLWNLLNVQENTGIELT
ESFAMWPGSSISGLYFAHPQSRYFSLGKIGRDQADDYHQRKGMSLAEVERWLGPNLNYDP
AQ
Download sequence
Identical sequences E8WW86
WP_013579791.1.56088 gi|322435037|ref|YP_004217249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]