SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322437156|ref|YP_004219368.1| from Granulicella tundricola MP5ACTX9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322437156|ref|YP_004219368.1|
Domain Number 1 Region: 94-286
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.41e-59
Family B3/B4 domain of PheRS, PheT 0.0000233
Further Details:      
 
Domain Number 2 Region: 370-586
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.52e-31
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00066
Further Details:      
 
Domain Number 3 Region: 594-689
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.27e-18
Family Anticodon-binding domain of PheRS 0.0038
Further Details:      
 
Domain Number 4 Region: 303-377
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000604
Family Domains B1 and B5 of PheRS-beta, PheT 0.0053
Further Details:      
 
Domain Number 5 Region: 1-81
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000125
Family Domains B1 and B5 of PheRS-beta, PheT 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|322437156|ref|YP_004219368.1|
Sequence length 693
Comment phenylalanyl-tRNA synthetase subunit beta [Granulicella tundricola MP5ACTX9]
Sequence
MKILTPWLRSYLPVLAVDDAQLAEDLTLRGIAVEGVFEVNDASGDSEGSVFDMDITTNRV
DAMNHYGMAREVAAIYDLPLHALDVSLPDAGAAETAFPVRIEAQDLCGRFTARVLRGVTV
APTDGVIGGYFDSLGLKKISNAVDVTNYVLQGMGHPTHAFDLDKIEGGIVVRRAKAGEQI
KLLDGTTRTLVVDDLVVADEVKALGLAGVMGGWDSMITAETKNVLVEAAWFQPATIRASS
RRHLIHTDASHRFERGADFAAAPIANALVSKLILEACGGRVEGELIDVVVAEHEAATANR
GTVALSVTEARRHLGTTVEPDGINAEVIHRYLTALGCTLTPVSVDGYEVRLPSWRLDLTR
EIDLIEEIARVYGYNGFANTLPTPGVVIDHPTARAERAVRERLLALGYSEALSSTFASAA
ESAQFAAGVAAVELENPLNEEAANLRPSLLPGMVTMLAHNLNRDVLNVRLFETGAVFSGG
TAEVSEAMSLSLGITGVSPVSNLYLAADASFYELKGAVESLVGLFAAPGLTFAAEASPVF
EAGRAAAASVNGKVVAQFGQLAASEGAKRKMRQPVYVATVDLAALLAMPLKHTTAKELSR
FQAVERDFSFVFANSVTWGDVEGAIRSLKIAELQSLRPIEVFRDEKKWPGVYSTLMRTVF
QSLDRTLTDEDVTGWWSAIISALQGLGGVIRDS
Download sequence
Identical sequences E8X4U9
gi|322437156|ref|YP_004219368.1| WP_013581899.1.56088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]