SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313682938|ref|YP_004060676.1| from Sulfuricurvum kujiense DSM 16994

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313682938|ref|YP_004060676.1|
Domain Number 1 Region: 29-178
Classification Level Classification E-value
Superfamily PEBP-like 1.83e-49
Family Prokaryotic PEBP-like proteins 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313682938|ref|YP_004060676.1|
Sequence length 180
Comment phospholipid-binding protein, pbp family [Sulfuricurvum kujiense DSM 16994]
Sequence
MRLPLLLSPLMILGALSLNAGEFTLHSNDLSGQLTKTQEFSGFGCDGKNISPELHWSDAP
KGTKSFALSVYDPDAPTGSGWWHWIVFNIPASTVSLPSGFGDTAQKHLIQATQSITDYGK
AGFGGACPPKGDRPHRYMFTVHALNVAHIDLDEKASPALVGYMINAHSIAKATIVSYYGR
Download sequence
Identical sequences E4U1D9
gi|313682938|ref|YP_004060676.1| WP_013460673.1.75161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]