SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313682169|ref|YP_004059907.1| from Sulfuricurvum kujiense DSM 16994

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313682169|ref|YP_004059907.1|
Domain Number 1 Region: 191-442
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.71e-61
Family Pyruvate oxidase and decarboxylase Pyr module 0.051
Further Details:      
 
Domain Number 2 Region: 5-210
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.62e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 456-554
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000183
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313682169|ref|YP_004059907.1|
Sequence length 559
Comment pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Sulfuricurvum kujiense DSM 16994]
Sequence
MKDSVSVLIGGKAGQGIASIETLLTKGFKRAGFYTFSTKEFMSRIRGGSNTTLIRISKRP
VNAPVFKVDIFVPLDTDSYYHALERISQETFLIAKKGDFECDCTLYDHDLPSLAKSIGSP
IVSNTIAAALVFGMLGCDLGILKEIVSELYQDEMLEINLRALDIGAQLAEDNGNCRYCIE
PNPISRKAGDFFLSGTEGVGFGSIAGGCNFICSYPMSPSTGVLTFLAKQSRTFGICVEQA
EDEIAAFQMGLGAWYSGGRAITTTSGGGFALMGEGLSLSGITETPMVVYLAQRPGPATGL
PTRTEQGDLELSIYSGHGEFPRIVLAPGDPKECFELTRMAFDLADQYQIPVIILSDQYLA
DSYFHIERFEIGSRQPVSRIVKTDAEYKRYCLSDNGISPRGIPGYGEGLVLVDSDEHTEE
GLITESMSVRNEQNGKRLQKINLIFDEAIVPEVEGEGDIIVLGWGSTKHIIKEAVERIGD
ERVSIIHFSWVHPLSESQLTPLREDKTIVVVENNATGQFAKLLRLHGIRVDHQILKSDGL
SFFVDELSKKLASALKEIR
Download sequence
Identical sequences E4U337
gi|313682169|ref|YP_004059907.1| WP_013459904.1.75161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]