SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32472540|ref|NP_865534.1| from Rhodopirellula baltica SH 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32472540|ref|NP_865534.1|
Domain Number 1 Region: 169-558
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-99
Family RecA protein-like (ATPase-domain) 0.0000000106
Further Details:      
 
Domain Number 2 Region: 3-135
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 4.97e-28
Family GSPII protein E N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|32472540|ref|NP_865534.1|
Sequence length 563
Comment general secretion pathway protein E [Rhodopirellula baltica SH 1]
Sequence
MIMHAGEILQRRGLLTPQQLEQSRNGDPQSVVDNAVTLGYVSARDALSAIADEVGLEFRD
LRTSEIDLSALEGFPQKLIYRHSMFPIGWDDGALLVATADPFDLYPLDEACATTGKTVVP
VVAERGEISRLVKKHLGVGSETVEGLVAAAGDEEVELLDGIETDGSELSEMAQEASVVRL
VNEILIEAVDSRASDIHIESQSDGLVIRYRIDGILHPQPVPPEINRFQAAIISRLKIMAR
LNIAEKRLPQDGRIKLRVHGREVDIRLSVIPMIHGEGLVMRVLDKSSMVFDLQGLGMSKE
IYDRFSQLIKLPHGIVLVTGPTGSGKTTTLYSSLLEIRSPENKIITTEDPVEYQLDGINQ
IQVHSKIGLTFAASLRSILRHDPDIVLVGEIRDLETAENATQASLTGHMVFSTLHTNDAA
GAFTRMVDMGVEPFLVAGTVEAVMAQRLLRRLCPHCKEAIRPDRDDLPKDFPWDEIEGKE
IYRSVGCRECRNVGYSGRLGIYELLVSSEQIREMAQNRASSWDIRRQAVKEGMRTLRMDA
WDKVVAGVTSVDEVLRVTKGEAL
Download sequence
Identical sequences K5DB77 L7CNX8 Q7UU66
gi|32472540|ref|NP_865534.1| NP_865534.1.48053 WP_007330716.1.82120 WP_007330716.1.98447 243090.RB3482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]