SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32472933|ref|NP_865927.1| from Rhodopirellula baltica SH 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32472933|ref|NP_865927.1|
Domain Number 1 Region: 38-142
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000000000000458
Family GSPII protein E N-terminal domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32472933|ref|NP_865927.1|
Sequence length 366
Comment type IV pilus assembly protein TapB [Rhodopirellula baltica SH 1]
Sequence
MNLTSVDFNQPSVGWLDEMWGQLEDTSHEEEPLEEQLADQCGLTDESKLASVYASHYLLP
LFEPPSGLAIPVDRRLQQCLPADFCEKHEVVPLAVQDHSLEVAIASPSALLLADEVRRLS
GLQMRPLFARATVVRRACHELFGDLKPTPKNAEATATASAVSTVETKNVKRQSIPQPPPV
EKTVVASPMNLTAYDLRSAERSAWQKQLVADSGLTIYCGRKGLDKSPLARLWGVWSSQTH
GRPASRWNPLQRESVESDPSVVIIPDLNSPTSAEVCLHSVLQGQRVFAVVHARDPVSAIL
RLRAWGQIGHSLAEQINLLIHQNGLSRSECRSIEIDDVRRSALASENDMGRLQKLFPSTG
SFLCGP
Download sequence
Identical sequences F2AYM4 Q7UT28
gi|32472933|ref|NP_865927.1| NP_865927.1.48053 WP_007328734.1.68031 243090.RB4151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]