SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32474719|ref|NP_867713.1| from Rhodopirellula baltica SH 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32474719|ref|NP_867713.1|
Domain Number 1 Region: 282-581
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.22e-86
Family DNA repair protein MutS, domain III 0.00000111
Further Details:      
 
Domain Number 2 Region: 583-815
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-65
Family ABC transporter ATPase domain-like 0.000000724
Further Details:      
 
Domain Number 3 Region: 1-109
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 8.63e-38
Family DNA repair protein MutS, domain I 0.000058
Further Details:      
 
Domain Number 4 Region: 111-295
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.83e-33
Family DNA repair protein MutS, domain II 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32474719|ref|NP_867713.1|
Sequence length 891
Comment DNA mismatch repair protein MutS [Rhodopirellula baltica SH 1]
Sequence
MTPMMRQYHEAKEACGDALLFFRMGDFYELFLDDAKVAAGILGLTLTSRDKDSENPTAMA
GFPHHQLDQYLQKLIRAGFRAAVCEQVEDPKAAKGLVRREITRVVSAGTLTDEGLLDPKE
PNYLAAVFAPSQKAREKAQKEAAKTNDPSGGDVVGIAWAELSSGRFEAGVFPRARLDDEL
ARIGPAEVLHCEDDASVHPDPTATWSWTARPAWSYAAADAEKSLCKQLSVANLEGLGFED
NGDVAIRAAGAVLCYLKETQRGSLDHFRSLTCHNRSPVLQIDAATRRSLEITRTMRTGSR
EGALLGVIDRTVTPMGSRMLADHLAAPLIDADAITYRTDAVDEFVRNNNLRSDIRTVLGD
TYDLTRLLARVATGRTGPRDLRQIAVTLSGLPALKARLAERDSACLTRLESELHLCPELR
EQLESALNDECPLSAADGNFIREGFDSELDTLRELARGGKRWIAEYQQRQMDETGIANLK
VGYNRVFGYYLEVSNAHKDKIPADFIRKQTLKNCERYITPELKEYEEKVLAADEKASSRE
QMLFTLLRENTHKHLAILQEVANAIAMTDVVASLAEVAAQHHWVRPTLTDDSVLRIEGGR
HPVLDVTMAQGEFVPNDCIQSPETGMILLITGPNMAGKSTYIRQVALITLLAQTGSFVPA
TSAEIGIADRIFARVGASDELSRGQSTFMVEMVETARILNTATSRSLVILDEIGRGTSTY
DGLSLAWAITEHLHEQIGARTLFATHYHELAALQETLPRVANLSVAVKEWQDEVVFLHRI
VPGSADKSYGIQVARLAGIPVEVNERAKDVLAQLEADHRDSLDRPTIAPPSGVNGKGSGD
TYQLTLFGYADHPLIQEIETVDIDSMSPIQAWQFLQEAKAKLSAGPKAVKG
Download sequence
Identical sequences Q7UP05
243090.RB7237 NP_867713.1.48053 gi|32474719|ref|NP_867713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]