SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32476178|ref|NP_869172.1| from Rhodopirellula baltica SH 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32476178|ref|NP_869172.1|
Domain Number 1 Region: 511-737
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-26
Family ABC transporter ATPase domain-like 0.00083
Further Details:      
 
Weak hits

Sequence:  gi|32476178|ref|NP_869172.1|
Domain Number - Region: 234-286
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000929
Family DNA repair protein MutS, domain III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|32476178|ref|NP_869172.1|
Sequence length 739
Comment mismatch binding protein [Rhodopirellula baltica SH 1]
Sequence
MGTRLESNLAFAGDRRLRDPELLLRRLARTKELGHLDQLLRRFDGRGTILARLRRWPLHV
LVPAIAVADHFSTQPSRPSGDESHRWTFASNPSVLHRIGCSLKRMSDYASQIETIDHDLK
DLETSDSRFAVWRMVFFVGLVLGIGFSLTTQHTIWICVAAGSLIAFLVTVVRNETVREQM
QLLRNHSRTLHRLQARLQRDWKSLARDSVGIRSSEIQLTPEQQALAGDLDLVGDASLFQL
TSMAATTPGVRTLANWLCSPVDPPLAKDRHSSVKYLADQPENRLRFYVLARDIGGSTGDP
ESFVQWSKEPNWLPPHRWLIPWGNFTAVVAILIVFGMIFGTITDQEDAARMGMYALIGIA
VLNLAIGSFLLGPVAAIFQIAMASRRSVNDYAELFDAANWLPESPTDPAGPTAHIRRTLL
SDDEDSHSASQGMRELAKIARMGGLKQTASTFLLYLPLQAFWLWDVRVLRRLEGWKSRYS
SQIPEWFDALGELEALMSIAALQHDSPNWSSPQWLEEESTIAFQGLGHPLLKDEARITND
VTIGPTGTLLLVTGSNMSGKSTMLRSAGLNVALAMAGGPVCCRHMSLPPVEMGTSIRVSD
DLSQGVSYYMAELNRLSAVVTHARKLAEQRAAGSTNRIQFFLLDEILQGTNSRERQIAVA
RVLRFLVDAGAIGAITTHDLELADDPELMKLAHTVHFRETITPDASGDERMTFDYKMRDG
VSPTTNALRLLEIVGLGEK
Download sequence
Identical sequences Q7UKS4
243090.RB9979 gi|32476178|ref|NP_869172.1| NP_869172.1.48053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]