SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32476901|ref|NP_869895.1| from Rhodopirellula baltica SH 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32476901|ref|NP_869895.1|
Domain Number 1 Region: 534-666
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 3.01e-31
Family GSPII protein E N-terminal domain-like 0.0043
Further Details:      
 
Weak hits

Sequence:  gi|32476901|ref|NP_869895.1|
Domain Number - Region: 921-1133
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00282
Family Protein prenyltransferases 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32476901|ref|NP_869895.1|
Sequence length 1283
Comment general secretion pathway protein E [Rhodopirellula baltica SH 1]
Sequence
MRSPRIFTMKRSLAKQLARGVHVGGQFVFVDLGAIDRDKVEFASDLHPAFSDIATNADQG
QCRLTIPIPQGERLTLPGVKVKATQPPPLALASLTCDRDLYRFGSDQVNVLVVDLDSPQQ
EVCVDLLLGTANGSPTQFDQRHVRLNECGLGIVRFDDLPIGTYQVVRADSPCKIDGCEFS
VAGFDLAPLVATIGQIQLRKKAMSCTLRISHFSKPLTGAIRVDLYDQKSRIDSRRVGVKQ
GLAIVGLEIDGDGPHHLEITLVKDSSATATIPLPGSERQQRRETVLTSSGPTTTASLMPG
QGTTEALGLHVRQTGQDNSPVQITDTLRGVVRIGAMQDIEDCVVCTCPFLSPRATSSEAA
NAPSPNTYSRRLGDLAAGEVIEFPSSELAGLISVGCFVDEKPWEARAVTLQRCNWNPSVR
IAQSNDSSNERELEDEFDRKASFEPGTNVSMAIDLGTEESGYAAVVIRDARLQPSSRPKQ
RLAASIKVAAEQALIGEVETQTVYGSSEQSERDPYWAHFSTRTPPIDDETLSKFVDRELI
SESQADHVMEAASECGKPYFTLLQDYGYAADDDMSRALAEIYGYQFVDLDNLSINEAIIE
LCPESIARENTVIPIREDFDGNLVFAMSNPIDLETIEKLRFILNRHIETVLATPDAIVEA
INHFYGQIEGESADSMLQEFTDSAIDFTETMDAGCESVVPNPVAANDSETALSPPEQLDA
EDAHVIFCELIECPSGRGQAAVELPERMGRYTVDSFVVSGRQWSHVENEFEVHADPYVKL
QVPAVLLDGDQASGRVIARCQSGNFSLTVDCDGTSVELHLADAPYDPVTTDHLTTAESEF
TFVVGLGRYTAKVCDRVSGKTREDIHQVKPLGKLVELRRTMRMLTDGERIELGDQIRQIR
LLPSVQPMKQMVAEATTNYDHLCCEQTAAKLFSAVVCLANQIGSGEPIEKSCTAIRVGLK
RQQRMWLPGKGFAIYPGNSPDVTWGRMATMHLLKMDFVSELIESNSMARSLLGEVRQLAR
ESAKHYRIAWPPESIGSSEDAYAQLRFGHGDQSQALEYARLQARKPIAGVRTFWRADQAM
AAAALLRGGSEQAGTRASDTAEATRLSNRLFDELGPEGRLYSTVDSVALIVLLLELSRTE
WMQSDCTITVNDQVQTIANAINSTEPIESLQTNHGTLAVEYLSYVEQDWMRFVSNTPITV
QLMVGGHAQTQFQEGDVIELRVRIKQGYKAGDLVWVALPPCLSRIQGGGQVKQFAVDMEG
ESETAIRLAATAPSSHPFCPPAS
Download sequence
Identical sequences Q7UEJ7
gi|32476901|ref|NP_869895.1| NP_869895.1.48053 243090.RB11294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]