SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32477703|ref|NP_870697.1| from Rhodopirellula baltica SH 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32477703|ref|NP_870697.1|
Domain Number 1 Region: 203-590
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.27e-98
Family RecA protein-like (ATPase-domain) 0.0000000193
Further Details:      
 
Domain Number 2 Region: 25-167
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 1.57e-35
Family GSPII protein E N-terminal domain-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32477703|ref|NP_870697.1|
Sequence length 596
Comment type IV fimbrial assembly protein PilB [Rhodopirellula baltica SH 1]
Sequence
MFRWLDVDFHFLWPCGPVPLSRSSTMAPRRIGQILVDLGFLTDDQLQIVLDEQEQQPGAL
FGKVAEDMQLVTDEQLIQALAEQMGMQTVSLEDAKLEPEVMEKISETMAQLYRCVPIQFE
GNTLTIATCDPQNLNIQDELRTFLGYDIKILVATEADVNKTITKYYDSEAESVEKLVAEL
AEDEELKAAASLLDNEKFNITDAEALADSAPVRKLLNMVLLLAIKDHASDIHFEPFEDEF
RIRIKSEGVLYEMVPPPRHLAFAITTRIKVMANLDIAERRMPQDGRIELMVGGHPVDLRV
SVLPTIFGESTVMRVLDRSVVNLSLDNVGMDEDMMSRFRSAIDRPNGIVLVTGPTGSGKT
TTLYSTLSELNEISEKLITTEDPVEYDIDGIIQIPIDSDAGVTFASCLRAILRQDPDTIL
VGEIRDLETAEISIQAALTGHLVFSTLHTNDSPSTVTRLTDMGIQPFMICATVEAILAQR
LVRRICTGCREKTRVSSDLLMELGMSREEIEATDYFKGVGCEKCNNTGYKGRIALFELMI
LNDTIREMIMHNASTDELRDQAQSDGMVILREFGMSLARDGITTLDEIVRETVVDG
Download sequence
Identical sequences Q7UI40
243090.RB12774 gi|32477703|ref|NP_870697.1| NP_870697.1.48053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]