SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32476372|ref|NP_869366.1| from Rhodopirellula baltica SH 1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|32476372|ref|NP_869366.1|
Domain Number - Region: 509-569
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000922
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|32476372|ref|NP_869366.1|
Sequence length 588
Comment sulfate transporter [Rhodopirellula baltica SH 1]
Sequence
MPAIECVGLCNGRGFHSIRDADFMMNAPSDSSTASMDTPPRGDISGFKRFLKDDLIAGGL
VFLIALPLCLGISLASGFPAIAGVFTAIVGSILTTFLSNSELTIKGPAAGMIVIVLGAVN
SFGYTAGVDPVADMQAYKMALAVGVVAGLVQIAFGLLRAGILGDFFPTAAVHGMLAAIGV
IIMVKQLPIVVGQSASGEPLEILQELPHLLMNANPEIALIGGVSLLILFGLAFLKSRTSD
GFINKIPGPLVVLLVAIPMGMAMNLSSDHTYTLMGKEFTVGESDLVTVPFNLFGAITFPD
FGVFLNSETLPAALGWVLMFALIGSLESLLSAKAVDMLDPHKRKTNLDRDLWAVGVGNMA
ASLIGGLPMISEIVRSKANIDNQAKTRFANMWHGVFLLGFVALLPGLIHNIPRAALAAML
VFTGFRLASPSEFRSVYRVGREQLIIFATTLVAVLATDLLIGIAIGIATKFAIHMINGVP
LRSLFVPTLQFDETSETEVNVHAGDSAVFSNWIGFRRQVVEKSLKQGKNCTVDFSDVHLI
DHSVMEKLHELEGEFAREGIELNVVGMDHHQPFSRHPMAARKRSFVSH
Download sequence
Identical sequences Q7UF60
gi|32476372|ref|NP_869366.1| NP_869366.1.48053 243090.RB10326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]