SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317046921|ref|YP_004114569.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317046921|ref|YP_004114569.1|
Domain Number 1 Region: 59-470
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.41e-143
Family TK-like PP module 0.00000000000103
Further Details:      
 
Domain Number 2 Region: 475-702
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.47e-96
Family TK-like Pyr module 0.00000000139
Further Details:      
 
Domain Number 3 Region: 703-886
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.79e-64
Family Transketolase C-terminal domain-like 0.0000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317046921|ref|YP_004114569.1|
Sequence length 888
Comment 2-oxo-acid dehydrogenase E1 subunit, homodimeric type [Pantoea sp. At-9b]
Sequence
MSERLHNDVDPIETRDWLQAIESVIREEGVERAQYLIDQVLSAARKGGVKVAAGSSAVSN
YINSIAVEDEPDYPGNTSLERRIRSAIRWNAIMSVLRASKKDLELGGHLSSFQSSATIYE
VCFNHFFRARSEKDGGDLVYFQGHISPGIYSRAFLEGRLTEEQMNNFRQEVHGNGLSSYP
HPKLMPEFWQFPTVSMGLGPLNAIYQAKFLKYLEHRGLKDTSAQTVYAFLGDGEMDEPES
KGAITIAVREKLDNLVFIINCNLQRLDGPVTGNGKIINELEGIFAGAGWNVIKVIWGARW
DELLKKDTSGKLIQLMNETVDGDYQTFKSRDGAYVREHFFGKYPETAALVKDWSDEEIFA
LNRGGHDPKKIYAALKKAQDTKGQPTLILAHTIKGYGMGDTAEGKNIAHQVKKMNMDGVR
YIRDRFNVPVADENIEKLPYVTFEKGSEEYNYLHGQREKLGGYLPTRQPNFTEKLDMPAL
EEFSALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLVPILADEARTFGMEGLFRQIGIY
SPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAGSSWLAAATSYSTNNLPMIPFYIY
YSMFGFQRIGDLMWLAGDQQARGFLVGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISY
DPSYAYEVAVIMHDGLVRMYGEAQENIYYYITTLNENYHMPAMPQGAEEGIRKGIYKLET
VDGSKGKVQLLGSGSILRHVREAAQILAKDYGIGSDVYSVTSFTELARDGQDCERWNMLH
PTETPRVPYIAQVMNEAPAVASTDYMKLFAEQVRSYVPASDYRVLGTDGFGRSDSRENLR
HHFEVDASYVVVAALGELAKRGEIDKKVVAEAITKFNIDADKVNPRLA
Download sequence
Identical sequences E6W7P1
gi|317046921|ref|YP_004114569.1| WP_013507881.1.99583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]