SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317047155|ref|YP_004114803.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317047155|ref|YP_004114803.1|
Domain Number 1 Region: 20-199,243-381
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.05e-76
Family TK-like PP module 0.012
Further Details:      
 
Domain Number 2 Region: 317-504
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.51e-57
Family TK-like Pyr module 0.032
Further Details:      
 
Domain Number 3 Region: 492-619
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.44e-31
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317047155|ref|YP_004114803.1|
Sequence length 621
Comment deoxyxylulose-5-phosphate synthase [Pantoea sp. At-9b]
Sequence
MSFDIAKYPTLALAGTVQELRLLPKEKLPALCDELRQYLLDSVSRSSGHFASGLGVVELT
VALHYVYNTPFDHLVWDVGHQAYPHKILTGRRDRIGTIRQKNGLHPFPWREESEYDVLSV
GHSSTSISAALGMAVAAEREGKGRRTAAIIGDGAITAGMAFEAMNHAGDIKPDMLVILND
NEMSISENVGALNNRLAQILSGKTYSRLREGGKRVLDNLPPIKELVKRTEEHLKGMVVPG
TLFEELGFNYIGPVDGHDVLALVSTLKNMRSLKGPQFLHIMTKKGKGYAPAEEDPITWHA
VPKFDPASGSLPKSAGGLPSYSKVFGNWLSEIAADDARLMAITPAMREGSGMVSFSRDYP
QQYFDVAIAEQHAVTFAAGMAIGGYKPIVAIYSTFLQRAYDQVIHDVAIQKLPVLFAIDR
GGIVGADGQTHQGAFDLAYLRCIPGMVIMTPSDENECRLMLYTGYHYQDGPSAVRYPRGT
GTGAALQPLASLPLGKGVVKRQGEKLAILNFGTLLPEATAAADALNATLVDMRFVKPLDE
ALITELAGSHDALITLEEGAIMGGAGSGVNEFVMAKRLRIPVLNLGLPDEFIPQGTQEEV
RHDYQLDAAGIQQQIASWLAQ
Download sequence
Identical sequences E6W7Y5
WP_013508114.1.99583 gi|317047155|ref|YP_004114803.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]