SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317047345|ref|YP_004114993.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317047345|ref|YP_004114993.1|
Domain Number 1 Region: 120-548
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.88e-89
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0052
Further Details:      
 
Domain Number 2 Region: 576-793
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.77e-52
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317047345|ref|YP_004114993.1|
Sequence length 935
Comment 2-oxoglutarate dehydrogenase, E1 subunit [Pantoea sp. At-9b]
Sequence
MQNSAMKPWLDSSWLAGANQSYIEQLYEDFLTDPDSVDAVWRDMFQQLPGTGVKPEQFHS
TTRDYFRRLAKDATRYTSTVTDPAANSKQVKVLQLINAFRFRGHQHANLDPLGLWKQDAV
PDLDPVYHDLTDADFQESFNVGSFAIGKETMKLADLYEALKQTYCGSIGAEYMHITNTDE
KRWIQQRIESVVGHATFSTEEKKGFLKELTAAEGLEKYLGAKFPGAKRFSLEGGDALVPM
LREMIRHAGKSGTREVVLGMAHRGRLNVLINVLGKKPQDLFDEFSGKHKEHLGTGDVKYH
MGFSSDVETEGGLVHLALAFNPSHLEIVSPVVMGSVRARLDRLAEPSSNKVLPITIHGDA
AVTGQGVVQETLNMSQARGYEVGGTVRIVINNQVGFTTSNPLDARSTPYCTDIGKMVQAP
IFHVNADDPEAVAFVTRLALDYRNTFKRDVFIDLVCYRRHGHNEADEPSATQPLMYQKIK
KHPTPRKIYADRLEADGIAKLEDATEMVNLYRDALDAGECVVPEWRPMSLHSFTWSPYLN
HDWDESYPATVEMKRLQELARRISQVPEAVEVQARVAKIYNDRKEMAEGNKAFDWGGAEN
LAYATLVDEGIPVRLSGEDSGRGTFFHRHAVVHNQANGSTYTPLHHIHHGQGQFKVWDSV
LSEEAVLAFEYGYATAEPRVLTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLL
PHGYEGQGPEHSSARLERYLQLCAEQNMQVCVPSTPAQVYHMLRRQALRGMRRPLIVMSP
KSLLRHPLAISTLDELANGSFQPAIGEIDALDAKQVKRVVMCSGKVYYDLLEQRRKNEKN
DVAIIRIEQLYPFPHKAVQEALKAYAHVQDFVWCQEEPLNQGAWYCSQHHFREVIPFGAS
LRYAGRPASASPAVGYMSVHQKQQQDLVNDALNLG
Download sequence
Identical sequences E6WC21
WP_013508300.1.99583 gi|317047345|ref|YP_004114993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]