SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317047534|ref|YP_004115182.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317047534|ref|YP_004115182.1|
Domain Number 1 Region: 358-559
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.54e-60
Family Pyruvate oxidase and decarboxylase PP module 0.00041
Further Details:      
 
Domain Number 2 Region: 182-351
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.53e-43
Family Pyruvate oxidase and decarboxylase, middle domain 0.00078
Further Details:      
 
Domain Number 3 Region: 2-174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.22e-42
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317047534|ref|YP_004115182.1|
Sequence length 573
Comment thiamine pyrophosphate domain-containing TPP-binding protein [Pantoea sp. At-9b]
Sequence
MKQTVAALLAKTLENAGVKRIWGVTGDSLNGLNDSLNRMGTIQWMPTRHEEVAAFAAGAE
AQITGQLAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQEL
FRECSHYCELVSNPEQLPQVLGIAMRKAILNRGVSVVVLPGDVALKPAPEGARADWYPPQ
LPQVVPSASEIARLALTLNGAKNITLMCGSGCAGAHAEVVKLAETLKAPVVHAMRGKEHI
EYDNPYDVGMTGLIGFSSGFQAMMNADTLVLLGTQFPYRPFYPAEATIIQIDINPASLGA
HSHVDMALVGDIKATLAALQPQLTSKSDRQHLDHALEHYADARKGLDELATANDKQAIHP
QYLAQQISHFAAEDAIFTCDVGTPTVWAARYLKMNGQRRLLGSFNHGSMANAMPQALGAQ
AINRDRQVVALCGDGGFSMLMGDFISVAQLKLPVKLVIFNNSVLGFVAMEMKAGGYLTDG
TELENPDFAAIATACGIKGIRVEKASALDSALEEAFAHDGPVLLDVITAKEELAIPPQIK
LEQAKGFSLYMLRAILNGRGDEVVELAKTNWLR
Download sequence
Identical sequences E6WB58
gi|317047534|ref|YP_004115182.1| WP_013508489.1.99583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]