SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317047773|ref|YP_004115421.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317047773|ref|YP_004115421.1|
Domain Number 1 Region: 6-173
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.16e-35
Family TK-like Pyr module 0.05
Further Details:      
 
Domain Number 2 Region: 176-310
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.7e-30
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317047773|ref|YP_004115421.1|
Sequence length 314
Comment transketolase domain-containing protein [Pantoea sp. At-9b]
Sequence
MSNAQHLANVMVNAFIDAVNRGIDLVPVVADSTSTAKIAPFIKAFPDRLVNVGIAEQTLV
GTAAGLAIGGKVAVTCNAAPFLISRANEQVKVDVCYNNTNVKLFGLNAGASYGPLASTHH
SIDDIAIMRGFGNIEIYAPSCPLECRQIIDYALDHVGPVYIRLDGKDLRQLHDDSYQFRP
GNIDVLRSGKDIALVAMGSTVHEIVDAAEQLQSQGIDAGVIAIPSIRPCDTQQLRELLNH
YPAVITVEEHNVNGGVGSLVAEVLAEGGCGIPLLRLGIPDGQYAIAGDRAATRARHSIDA
ASVVNNAVRICTGE
Download sequence
Identical sequences E6WB96
WP_013508726.1.99583 gi|317047773|ref|YP_004115421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]