SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317048250|ref|YP_004115898.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317048250|ref|YP_004115898.1|
Domain Number 1 Region: 796-1169
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.59e-122
Family PFOR PP module 0.0000000289
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.88e-72
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000144
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.71e-70
Family PFOR Pyr module 0.00000011
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.04e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000283
Further Details:      
 
Domain Number 5 Region: 665-837
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.93e-22
Family Ferredoxin domains from multidomain proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317048250|ref|YP_004115898.1|
Sequence length 1175
Comment pyruvate ferredoxin/flavodoxin oxidoreductase [Pantoea sp. At-9b]
Sequence
MITVDGNGAVASVAFRTSEVIAIYPITPSSTMAELADGWSGEGRRNIWGDVPRVVEMQSE
GGAIATVHGALQTGSLSTSFTSSQGLLLMIPTLYKLAGQLMPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAQLCASSVQEAQDFALIAQMASLNSRIPFIHFFDGFRTSHEINKIV
PISDETLLTLMPQEAIAQHRARALTPDHPSVRGTSANPDTYFQSREATNRWYDACTGHVE
SAMAAFAAQTGRRYQPFEFYGHPQAERVIVMMGSGCGTAEEAIDELLQRGEKVGLVKVRL
YRPFSAQHLLSVLPLSAQRVAVLDRTKEPGALGEPLFLDVMTALAEAFSRGERRTLPQVC
GGRYGLSSKEFAPDAVLAVFRALQRPQPPARFTVGIYDDVTHLSLPPEANIVPNRAHLEA
LFYGLGSDGSVSATKNNLKIIGNATPWQVQGYFVYDSKKAGGLTVSHLRVSQQPIQSAYL
IQQADFIGCHQLQFIDKYSMLDQLKPGGIFLLNTPYAADEVWHRLPQEVQTQLNDKQARF
YVINAARIARECQLGARINTVMQMAFFQLTQILPGDSALSELQNAIARSYRSKGEELVQR
NWQALAMAQQALEAVPLQAVDADSPHRPPVVAANAPDFVKTVTAAMLAGLGDKLPVSALP
PDGSWPTGTTQWEKRNIAEAIPIWQPDLCTQCNHCVAACPHSAIRAKVVTPEALEGAPIS
LASLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPASDRQHPEIKAINMQSRLEHVETE
KINYDAFLALPEISAEQLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRLL
IANATGCSSIYGGNLPSTPYTTNAEGRGPAWANSLFEDNAEFGLGFRLSVDQQRQRALRL
LEQCAAQLPATLVAELKGDNVTTSVRREQISQLRAHLQHAPHAAAQALIAAADALVDKSV
WLIGGDGWAYDIGYGGLDHVMSLSENVNVLVLDTQCYSNTGGQASKATPLGAVTKFGEQG
KRKARKDLGMATLLYGHVYVAQISLGAQLNQTVKAIQEAEAWPGPSLIIAYSPCEEHGYD
LAYSHEQMRLLTTSGFWPLYRFDPRRAEQGKAALALDSRPPTSELEQALMNEQRFRQLQT
EQPEAAAQLWRDASEAANQRYQRLAELAGKAEKSE
Download sequence
Identical sequences E6WDN6
gi|317048250|ref|YP_004115898.1| WP_013509198.1.99583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]