SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317049026|ref|YP_004116674.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317049026|ref|YP_004116674.1|
Domain Number 1 Region: 355-545
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.16e-46
Family Pyruvate oxidase and decarboxylase PP module 0.000000299
Further Details:      
 
Domain Number 2 Region: 5-180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.53e-40
Family Pyruvate oxidase and decarboxylase Pyr module 0.000000521
Further Details:      
 
Domain Number 3 Region: 169-347
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.61e-30
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317049026|ref|YP_004116674.1|
Sequence length 549
Comment thiamine pyrophosphate domain-containing TPP-binding protein [Pantoea sp. At-9b]
Sequence
MKTLKVGEYLLMRLQQAGVRHLFGVPGDYNLQFLDSVIAHPDITWVGCANELNAAYAADG
YGRCNGAAALLTTFGVGELSAINGIAGSYAEYVPVIHIVGAPASEVQRQGDCVHHSLGDG
DFRHFSRMAEEVSVASAVLTAANAAQEIDRVIGEALHQRRPGYLLLAVDVAQAEIALPLP
AATTTTPPPSAVAAFALAAETLLASARQVALLADFLAARWQLQPQLAALRQLRSIPAATL
LMGKGVLDEQQPGFVGTYAGEGSTPAVRAAIEDTDVTICVGVRFTDTVTAGFTQQLPAEK
LIDLQPFHAVVAGATFAPLTMAEALEALLPLFRRYGEHWATANALEWQQTPDAKAFLSQH
TFWQAMQHFLRPGDIILADQGTAAFGAAALRLPHDAQLLVQPLWGSIGYTLPAAFGAQTA
QPDRRVILIIGDGSAQLTIQELGSMQRDGQQPIIFLLNNEGYTVERAIHGAHQRYNDIAQ
WNWTALPQALSLTGEAQSWRVSETQQLEAVMARLAQNQRLALVEVVLDKDDIPPLLRKVT
ASLHQRNGG
Download sequence
Identical sequences E6WBR2
WP_013509972.1.99583 gi|317049026|ref|YP_004116674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]