SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317049408|ref|YP_004117056.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317049408|ref|YP_004117056.1|
Domain Number 1 Region: 5-330
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.31e-120
Family TK-like PP module 0.0000000000533
Further Details:      
 
Domain Number 2 Region: 333-526
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.52e-68
Family TK-like Pyr module 0.0000000439
Further Details:      
 
Domain Number 3 Region: 533-663
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.44e-42
Family Transketolase C-terminal domain-like 0.00000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317049408|ref|YP_004117056.1|
Sequence length 663
Comment transketolase [Pantoea sp. At-9b]
Sequence
MPSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLNHNPTNPQWAARDRF
VLSNGHGSMLIYSLLHLTGYDLPMSELQNFRQLHSKTPGHPEYGYTAGVETTTGPLGQGI
ANAVGFAIAERTLAAQFNRPGHDIVDHNTYVFMGDGCMMEGISHEVCSIAGTLKLGKLVA
FYDDNGISIDGHVDGWFTDDTAKRFEAYGWHVVRGVDGHDADAIKKAVEEAKAVTDKPSL
LMCKTIIGFGSPNKAGTHDSHGAPLGDAEVALTRKQLGWDYAPFEIPADIYAQWDAKEAG
KAKEAAWDEKFAAYAAAHPELAAEFKRRMNNELPANWAEESQKFVEQLQANPAKIASRKA
SQNAIEAFGKILPEYLGGSADLAPSNLTMWSGSKPINEDAAGNYIHYGVREFGMTAIANG
IALHGGFLPYTATFLMFVEYARNAARMAALMKIRQIMVYTHDSIGLGEDGPTHQPVEQMA
SLRTTPNMSLWRPCDQVESAVAWKYAIERKDGPSALIFSRQNLAQQDRSAEQLANVARGG
YVLKDCAGQPELILIATGSEVELAVGAYDQLTTEGRKVRVVSMPSTDAFDKQDAAYRESV
LPKAVAARVAIEAGIADYWFKYTGLNGAIVGMTSFGESAPAEKLFEEFGFTVANVVATAK
SIL
Download sequence
Identical sequences E6W8L0
gi|317049408|ref|YP_004117056.1| WP_013510352.1.99583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]