SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317050038|ref|YP_004117686.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317050038|ref|YP_004117686.1|
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.21e-64
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000036
Further Details:      
 
Domain Number 2 Region: 357-545
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.11e-63
Family Pyruvate oxidase and decarboxylase PP module 0.00000779
Further Details:      
 
Domain Number 3 Region: 181-342
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.89e-57
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317050038|ref|YP_004117686.1|
Sequence length 548
Comment acetolactate synthase large subunit [Pantoea sp. At-9b]
Sequence
MTGAQWVVQALRAQGVDTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAVMAAIGYARA
TGKTGVCIATSGPGATNLITGLADAMMDSIPVVAITGQVASPFIGTDAFQEIDVLGLSLA
CTKHSFLVESLDDLPSVMAEAFAIAQSGRPGPVLVDIPKDIQIANGDLTPHLLPVEEALS
HSPQHIAEARALMAQAKKPMLYIGGGVGMAQAVPALRAMAIDTGIPMVATLKGLGSADAN
SDLYLGMLGMHGTKAANLAVQECDLLIAVGARFDDRVTGKLDTFAPHASVIHIDIDPAEL
NKLRRAHVSLQGDLNQVLPALSMPLQIDAWRSAVKAMKAEFDWRYDHPGDAIYAPLLLKQ
LSDRKADSAVVTTDVGQHQMWAAQHMSFSAPENFITSSGLGTMGFGLPAAVGAQVARPND
TVICVSGDGSIMMNIQELGTIKRGKLPVKILLLDNQRLGMVRQWQQLFFDGRYSETILTD
NPDFLTLASAFDIPGQRITRKDQVDAALDALLNSEGPYFLHVAIDEHENVWPLVPPGASN
ANMMEKTV
Download sequence
Identical sequences E6W8X9
gi|317050038|ref|YP_004117686.1| WP_013510964.1.99583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]