SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317053187|ref|YP_004118954.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317053187|ref|YP_004118954.1|
Domain Number 1 Region: 785-1168
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.01e-128
Family PFOR PP module 0.00000000147
Further Details:      
 
Domain Number 2 Region: 418-669
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.02e-84
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000132
Further Details:      
 
Domain Number 3 Region: 3-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-78
Family PFOR Pyr module 0.0000000221
Further Details:      
 
Domain Number 4 Region: 259-405
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.34e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000161
Further Details:      
 
Domain Number 5 Region: 666-830
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.05e-19
Family Ferredoxin domains from multidomain proteins 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317053187|ref|YP_004118954.1|
Sequence length 1169
Comment pyruvate ferredoxin/flavodoxin oxidoreductase [Pantoea sp. At-9b]
Sequence
MSGTMKTMDGNAAAAWISYAFTDVAAIYPITPSTPMAENVDEWAAAGKKNLFGQPVKVME
MQSEAGAAGAVHGALQAGALTTTYTASQGLLLMTPNLYKIAGELLPGVFHVSARALATNS
LNIFGDHQDVMAVRQTGCAMLAESNVQQVMDLSAVAHLSAIKGRVPFINFFDGFRTSHEI
QKIEVLEYDELAPLLDIDALNRFRRHALNPDHPVIRGTAQNPDIYFQEREASNGFYAALP
DIVENYMAEIAAITGREYHLFDYYGADDAEDMIVAMGSVCDTIQDVVDALLDSGEKVGVL
MVHLFRPFSLAHFFARIPASVKRIAVLDRTKEPGAQAEPLCLDVKNAFYRHDNPPLIVGG
RYALGGKDILPSHIVSVFENLKKPLPQDGFTLGIFDDVTHTSLPLPVHEVQVSTEGITAC
KFWGLGSDGTVSANKSAIKIIGDNTPMYAQAYFAYDSKKSGGITVSHLRFGHHPINAPYL
IHRADFIACSQQSYVDKYDLLEGLTPGGTFLLNCTWFGEELEEKLPASVKRYIARNSIRF
YTLNAVEIARKLGLRGRFNMLMQAAFFKLAGIIDPPTAAIYLKQAVEKSYGSKGQNVVDM
NNAAIDLGMEAIQEVMVPERWAMQEDKPAPARLLPDFISNILEPMNRQCGDKLPVSTFAG
MEDGTFPTGTAAWEKRGIALEVPVWQPEGCTQCNQCAFICPHAAVRPALLTTEERYFAMP
ELLSKPAQGATDYEYHLAISPLDCSGCGNCVDICPAKGKALSMKPLETQRHMSSVWNYAL
ELAPKINPFGKTSVKGSQFETPLLEFSGACAGCGETPYARLVTQLFGDRMMIANATGCSS
IWGASAPSIPWTTNHKGQGPAWANSLFEDNAEFGLGMMLGGRAIRDQLAQYATEALNRPL
SAGLQQALQQWLALKDQGNGTRERGERLSTLLAEEKGDDDLLNRLYQNQDYFAKRSQWIF
GGDGWAYDIGFGGLDHVLASGEDINVLVYDTEVYSNTGGQSSKSTPVAAIAKFAAQGKRT
RKKDLGMMALSYGNVYVAQIAMGADKAQTLRAIAEAEAWPGPSLVIAYAACINHGLKAGM
GCSHREAKRAVEAGYWHLWRYNPQLAEKGKNPFMLDSEEPEDSFRDFLLGEVRYAALRRT
APDLVDRLFEQTEQDAKQRFEQYRRMAGD
Download sequence
Identical sequences D1KS65
gi|317053187|ref|YP_004118954.1| gi|317053187|ref|YP_004118954.1|NC_014840 WP_013512227.1.99583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]