SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317053307|ref|YP_004119074.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317053307|ref|YP_004119074.1|
Domain Number 1 Region: 186-365
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.24e-42
Family Pyruvate oxidase and decarboxylase, middle domain 0.0017
Further Details:      
 
Domain Number 2 Region: 395-597
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.15e-41
Family Pyruvate oxidase and decarboxylase PP module 0.004
Further Details:      
 
Domain Number 3 Region: 2-211
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.72e-28
Family Pyruvate oxidase and decarboxylase Pyr module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317053307|ref|YP_004119074.1|
Sequence length 614
Comment thiamine pyrophosphate protein central region [Pantoea sp. At-9b]
Sequence
MAKIRCTTAQAIVRYLSNQFTEVDGERVPLFPGVYGIFGHGNVTCLGEALEAAQDVLPTW
RGQNEQSMAFAAVGFAKAMVRRQIMVVTASIGPGTTNLLTAAGVAHTSRLPVLMICGDSF
ARRIPDPVMQQVEHFNDPTQTVNDAFKAVSRYWDRITWPEQIMSSLPQAVATLLDPGDCG
PAFIGVCQDVQEMAYDYPEEFFSPRLHTMPRPRPDRRLLEQAVQLLKTAKRPLIISGGGV
RYSQAEATLEAFATEHGIPVVETIAGKGAFTHDHPMHMGPVGILGSTSANELAANADVII
AIGTRLMDFVTGSWTLFDHGAQFIALNAARFDAHKHRSLPLICDAREGIAEMHAALGAWQ
ADAAWLERGRNAFISWNTLIADKQEHTDHGTAPSYAQVIGVVNAQAAAEDYIISAAGGLP
GELVKGWRVKNPGTFDCEFGFSCMGYELSAGWGAAMAGNARDVFVMIGDGTYMMMNSDIY
SSVLSGHKFILLVCDNGGYAVINRLQNAKGGASFNNLLKDCRVQEPFHVDFVANAQSMGA
LARKVTRLDELAEAIKWAKGNDRTTVISIETHPYTWTPGDAWWDVGVPEVSARDSVNQAR
AEHVAGRKHQRAGI
Download sequence
Identical sequences E6WM83
gi|317053307|ref|YP_004119074.1|NC_014840 WP_013512347.1.99583 gi|317053307|ref|YP_004119074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]