SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317053571|ref|YP_004118705.1| from Pantoea sp. At-9b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317053571|ref|YP_004118705.1|
Domain Number 1 Region: 371-550
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.58e-49
Family Pyruvate oxidase and decarboxylase PP module 0.0000000619
Further Details:      
 
Domain Number 2 Region: 11-182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.8e-47
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000023
Further Details:      
 
Domain Number 3 Region: 191-358
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.27e-34
Family Pyruvate oxidase and decarboxylase, middle domain 0.000000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317053571|ref|YP_004118705.1|
Sequence length 559
Comment acetolactate synthase, catabolic [Pantoea sp. At-9b]
Sequence
MKELNIPTIWKSGADLVVAQLEAQGVSHVFGIPGAKIDRVFDSLVDSRIELIPVRHEANA
AFMAAAVGRLTGNAGVALVTSGPGCSNLVTGMATATSEGDPVVALGGAVKRSDSAKQVHQ
SMDTVSMFRPVTKFSVEVTDSSALAECVSNAFRHAENGRGGGAFISLPQDIVNQPVSADL
LVHKGRVTLGAAPDSLVDVVSREIVRAKNPVILLGLMASQPENSAAIHDLLNKSRIPVTS
TYQAAGAVRQEHFSRFAGRIGLFNNQAGDRLLQQADLIITIGYSPVEYEPAMWNTGNAIL
VHIDVLPAETDNRYIPDAELIGDIAQTVRKVAARIEAPLQLSDASAAILEDRQQQRQLLA
MQGASLNQFALHPLRIVRAMQDIINSDVSLTVDMGSFHIWIARYLYSFRARQIMISNGQQ
TMGVALPWAIGAWLVDTSRKVVSVSGDGGFLQSSMELETAVRLKANIVHIIWVDNAYNMV
AMQEDKKYQRVSGVNFGPVDFRTYAEAFGAAGFSVNSAAELEPTLRRAMDVQGPAVVAIP
VDYSDNPLLMGQLHLSQLL
Download sequence
Identical sequences E6WL64
gi|317053571|ref|YP_004118705.1|NC_014839 WP_013511978.1.99583 gi|317053571|ref|YP_004118705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]