SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337751203|ref|YP_004645365.1| from Paenibacillus mucilaginosus KNP414

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337751203|ref|YP_004645365.1|
Domain Number 1 Region: 2-288
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 4.32e-69
Family ADP-ribosylglycohydrolase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|337751203|ref|YP_004645365.1|
Sequence length 295
Comment ADP-ribosyl-(dinitrogen reductase) hydrolase [Paenibacillus mucilaginosus KNP414]
Sequence
MNIMDRIRGGLYGTAVGDALGGTTEFMTRAEIRKKYGRLTEMIGEGVWDLEPGEVTDDTM
MSLCVAEGILASPEDPMGAIGERFLDWYRSDPKDIGNIIRRALQRYEGDWLEASFVTNRD
LGGFSAGNGSLMRCLPAALIYTDRERMETVTRMQSKMTHWDERCSEACVMYNRMAYRLLQ
GEELGLVLALETAGTPYAEALGGEPDCGPTGYVVDTFRWVLYILNTTQSFVETVQEAANL
GGDTDTIGAIAGGLAGVHYGYGSIPEAYAGKILVKERLDELAERVAAYRREAGDR
Download sequence
Identical sequences F8FIP1 H6NKR2
gi|337751203|ref|YP_004645365.1| WP_013920637.1.16585 WP_013920637.1.63014 gi|379724217|ref|YP_005316348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]