SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568179903|ref|YP_008952416.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568179903|ref|YP_008952416.1|
Domain Number 1 Region: 46-145
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000000051
Family Multidrug resistance efflux transporter EmrE 0.023
Further Details:      
 
Domain Number 2 Region: 211-285
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000131
Family Multidrug resistance efflux transporter EmrE 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568179903|ref|YP_008952416.1|
Sequence length 295
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MHAANPRRGYLLGLSAYIIWGLFPLYFKAIQSVPAVEIIVHRVLWSALFGSLLLLVWKHP
GWWRELRDNPRRLGILALSGALIAGNWLTYVWSVNNGRMLEASLGYYINPLINVLLGMLI
LGERLRRLQWLAVAMAAVGVAQQVWQVGSLPWVSLVLALSFGFYGLIRKQAPVAALPGLV
VETWMLVPLALGWLLLHPAATSAQGAFYTSSEALWLMAAGPVTLVPLVCFNAAARHLPYT
TLGFLQYLAPTLVLLQAVLLFDEHLSSSNLVAFMFIWAGLAIYSVDAWVSLRKRS
Download sequence
Identical sequences A0A059UUI5 A0A099MU43 F8FZM9 V9UUZ8 V9WQT4
2035935533 gi|568179903|ref|YP_008952416.1| gi|339485291|ref|YP_004699819.1| WP_013970552.1.23948 WP_013970552.1.28354 WP_013970552.1.32670 WP_013970552.1.35335 WP_013970552.1.41505 WP_013970552.1.52768 WP_013970552.1.56258 WP_013970552.1.61620 WP_013970552.1.65739 WP_013970552.1.7288 WP_013970552.1.76210 WP_013970552.1.76710 WP_013970552.1.80759 WP_013970552.1.92076 WP_013970552.1.9402 gi|568185341|ref|YP_008957852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]