SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180027|ref|YP_008952543.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180027|ref|YP_008952543.1|
Domain Number 1 Region: 1-57
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 2.22e-19
Family Ribosomal protein L30p/L7e 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180027|ref|YP_008952543.1|
Sequence length 58
Comment 50S ribosomal protein L30 [Pseudomonas monteilii SB3078]
Sequence
MATVKVTLIKSVSGRLPNHKLCVKGLGLRRIGHTVEVQDTPENRGMINKAYYMLKVEG
Download sequence
Identical sequences A0A099MUK7 A0A0A7PSY4 A0A0C1I2M4 A0A0E9ZFB2 A0A0H1BTR8 A0A0M2UF89 A0A136QH70 A0A160ITH5 A0A173HL23 A0A1L5PMI7 A0A1W2F4K5 A0A1X7E6R2 A0A212SKQ5 A0A285YRB6 A0A2G8N061 A0A2I0CDM1 A0A2K4LKF6 A5VXR5 B0KK85 E2RY76 F8G138 I3UWX2 I7C854 J8VFE5 L0FER7 Q88QL7 V7D672 V9UVB3 V9WSB8
gi|395446855|ref|YP_006387108.1| gi|26987213|ref|NP_742638.1| gi|568180027|ref|YP_008952543.1| gi|397696217|ref|YP_006534100.1| 2035967718 NP_742638.1.35174 WP_003255463.1.100978 WP_003255463.1.10374 WP_003255463.1.10502 WP_003255463.1.1079 WP_003255463.1.1090 WP_003255463.1.11138 WP_003255463.1.13892 WP_003255463.1.15314 WP_003255463.1.1643 WP_003255463.1.16466 WP_003255463.1.16597 WP_003255463.1.16675 WP_003255463.1.16930 WP_003255463.1.17434 WP_003255463.1.19681 WP_003255463.1.19780 WP_003255463.1.23948 WP_003255463.1.25319 WP_003255463.1.25626 WP_003255463.1.28157 WP_003255463.1.28295 WP_003255463.1.28354 WP_003255463.1.28475 WP_003255463.1.3142 WP_003255463.1.31851 WP_003255463.1.32670 WP_003255463.1.32932 WP_003255463.1.33269 WP_003255463.1.33515 WP_003255463.1.33725 WP_003255463.1.34900 WP_003255463.1.35335 WP_003255463.1.35716 WP_003255463.1.35996 WP_003255463.1.36216 WP_003255463.1.36333 WP_003255463.1.36363 WP_003255463.1.38432 WP_003255463.1.38888 WP_003255463.1.41 WP_003255463.1.41505 WP_003255463.1.42045 WP_003255463.1.42506 WP_003255463.1.42658 WP_003255463.1.42801 WP_003255463.1.43930 WP_003255463.1.44137 WP_003255463.1.45427 WP_003255463.1.47320 WP_003255463.1.48025 WP_003255463.1.51289 WP_003255463.1.51843 WP_003255463.1.52680 WP_003255463.1.52768 WP_003255463.1.54338 WP_003255463.1.54657 WP_003255463.1.5613 WP_003255463.1.56258 WP_003255463.1.57632 WP_003255463.1.58218 WP_003255463.1.59340 WP_003255463.1.59535 WP_003255463.1.60844 WP_003255463.1.61620 WP_003255463.1.62279 WP_003255463.1.62773 WP_003255463.1.6330 WP_003255463.1.64196 WP_003255463.1.65173 WP_003255463.1.65540 WP_003255463.1.65739 WP_003255463.1.66485 WP_003255463.1.66713 WP_003255463.1.675 WP_003255463.1.67665 WP_003255463.1.71439 WP_003255463.1.71479 WP_003255463.1.71624 WP_003255463.1.71677 WP_003255463.1.72006 WP_003255463.1.7288 WP_003255463.1.73136 WP_003255463.1.73516 WP_003255463.1.7435 WP_003255463.1.74522 WP_003255463.1.74642 WP_003255463.1.7467 WP_003255463.1.75010 WP_003255463.1.75189 WP_003255463.1.76210 WP_003255463.1.76710 WP_003255463.1.78345 WP_003255463.1.78427 WP_003255463.1.80759 WP_003255463.1.81634 WP_003255463.1.83952 WP_003255463.1.8488 WP_003255463.1.87606 WP_003255463.1.89748 WP_003255463.1.92076 WP_003255463.1.93113 WP_003255463.1.9402 WP_003255463.1.95600 WP_003255463.1.95946 WP_003255463.1.96951 WP_003255463.1.98117 WP_003255463.1.98215 WP_003255463.1.99927 WP_003255463.1.9999 gi|148545757|ref|YP_001265859.1| gi|386010131|ref|YP_005928408.1| gi|167031518|ref|YP_001666749.1| 2031830622 2030780175 gi|568185461|ref|YP_008957976.1| gi|339485405|ref|YP_004699933.1| 160488.PP_0472 351746.Pput_0505 76869.PputGB1_0502 gi|431800525|ref|YP_007227428.1| 2030259773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]