SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180127|ref|YP_008952644.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180127|ref|YP_008952644.1|
Domain Number 1 Region: 212-647
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.88e-91
Family beta-Lactamase/D-ala carboxypeptidase 0.0011
Further Details:      
 
Domain Number 2 Region: 45-262
Classification Level Classification E-value
Superfamily Lysozyme-like 9.56e-64
Family PBP transglycosylase domain-like 0.0000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568180127|ref|YP_008952644.1|
Sequence length 784
Comment penicillin-binding protein 1C [Pseudomonas monteilii SB3078]
Sequence
MPSLTRPHTRAGRLLRATVIGMLVLFGLLWLADRLWPLPMPGDDLARVVLAEDGTPLWRF
ADADGVWRYPVSSDEVSPLYLQALLTYEDRWFYSHPGVNPLALARAAWLNLRGGRVVSGG
STLSMQVARLLDPHERTLAGKLRQLWRTAQLEWHLSKREILQIYLDRAPFGGTLQGVAAA
SWAYLGKSPMHLTPAEAALLAVLPQAPSRLRPDRHPERAQRARDKVLQRLAEYQVWPAQQ
IREAAEEPLVLAPRQEPALAPLLARRLNSADSPPLIRTTLDAALQRRLEDLLLGWRARLP
ERTSAAILVVDAQTMAVRAYLGSIDLADERRFGHVDMVRSLRSPGSTLKPFLYGMALDDG
LIHSESLLQDVPRRYGDYRPGNFSMGFSGPVSASSALALSLNLPAVQLLEAYGPKRFAAQ
LRMAGMPLILPPLAEPNLSLILGGAGSRLEDLVGGYAALARGGNSARVRLQPQDPLLERR
LLSPGAAWIIRRILSGQARPDRDPHAELVQRPQLAWKTGTSYGFRDAWSIGVGPRYLIGV
WIGRPDGTPVPGQFGLASAAPLMLQVHDLLSNRDSQRGISVPVERVPANVGVAAICWPLG
QPMSKKDPNCRRQRFAWTLDGTTPPTLQAADQPLGLGLRESVWVNDQGLRVDGSCPGAKA
RDIALWPAPLEPWLPRVERRAARLPAIDPACPPHVPVSAPPLSIVGVRPGDNLRRPATSS
EPLQLHVSALGGGGRRWWFLNGQPLGETQGQDSLLVRFQQVGQAEISALDESGETARVAF
QVSE
Download sequence
Identical sequences A0A2A3LX38 V9UVK5
WP_024086198.1.23948 WP_024086198.1.28354 WP_024086198.1.56258 WP_024086198.1.80759 gi|568180127|ref|YP_008952644.1| gi|568185561|ref|YP_008958077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]