SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180149|ref|YP_008952666.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180149|ref|YP_008952666.1|
Domain Number 1 Region: 92-216
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 6.07e-42
Family Tetracyclin repressor-like, C-terminal domain 0.0000655
Further Details:      
 
Domain Number 2 Region: 17-95
Classification Level Classification E-value
Superfamily Homeodomain-like 4.41e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568180149|ref|YP_008952666.1|
Sequence length 220
Comment TetR family transcriptional regulator [Pseudomonas monteilii SB3078]
Sequence
MTLEVPAHRLSASGKPAGRIRQKNEQAIIQAAEDEFARHGFKGTSMNTIALKAGLPKANL
HYYFTNKLGLYIAVLSNIIELWDSTFNALSVDDDPGEALSQYIRTKMEFSRRNPQASRIF
AMEVISGGTCLSEYFSADYREWFRGRAAVFQAWIEAGKMDPVDPVHLIFLLWGSTQHYAD
FATQICQVTGRSRLTKQDMEDASNNLIHIILKGCGIKPAA
Download sequence
Identical sequences A0A059UV40 A0A099MV33 A0A0C1KB98 A0A136QGV9 F8G3F6 J8V025 L0FF74 V9UWW5 V9WUJ4
gi|431800653|ref|YP_007227556.1| gi|339485530|ref|YP_004700058.1| gi|568185583|ref|YP_008958099.1| gi|568180149|ref|YP_008952666.1| WP_003257076.1.1643 WP_003257076.1.23948 WP_003257076.1.28354 WP_003257076.1.32670 WP_003257076.1.35335 WP_003257076.1.36363 WP_003257076.1.41505 WP_003257076.1.42658 WP_003257076.1.52768 WP_003257076.1.56258 WP_003257076.1.57632 WP_003257076.1.59340 WP_003257076.1.61620 WP_003257076.1.65739 WP_003257076.1.71677 WP_003257076.1.7288 WP_003257076.1.7435 WP_003257076.1.76210 WP_003257076.1.76710 WP_003257076.1.80759 WP_003257076.1.92076 WP_003257076.1.9402 WP_003257076.1.95946 WP_003257076.1.99927 2035935224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]