SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180158|ref|YP_008952675.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180158|ref|YP_008952675.1|
Domain Number 1 Region: 174-309
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 8.28e-43
Family ATP-dependent riboflavin kinase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 15-175
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.78e-33
Family Adenylyltransferase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568180158|ref|YP_008952675.1|
Sequence length 316
Comment FAD synthetase [Pseudomonas monteilii SB3078]
Sequence
MQLVRGLHNLRPEHRGCVATIGNFDGVHRGHQAILARLRERGQALGLPTCVVIFEPQPRE
YFAPGTAPARLARLRDKIELLAAEGIDRVLCLAFNQRLSKLGADAFVKAILVDGLGVRHL
EVGDDFRFGCDRAGDFAFLVEAGKQYGFTVEAANTVIQDGLRVSSTEVRKALSEGNFELA
EHLLGRPYRISGRVLHGQKLARQLGTPTANIQLKRRRVPLSGVYLASIEIDGKAWPGVGN
IGVRPTVAGDGRPHLEIHLLDYAGDLYGRRLTVEFHHKLREEQRFASLEALKSAIDADIA
AARAHWHAQPLTKSLK
Download sequence
Identical sequences V9USC5
gi|568180158|ref|YP_008952675.1| gi|568185592|ref|YP_008958108.1| WP_024086211.1.23948 WP_024086211.1.28354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]