SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180204|ref|YP_008952723.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180204|ref|YP_008952723.1|
Domain Number 1 Region: 160-325
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 3.66e-46
Family Homoserine dehydrogenase-like 0.00083
Further Details:      
 
Domain Number 2 Region: 2-181
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.53e-20
Family Aminoacid dehydrogenase-like, C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568180204|ref|YP_008952723.1|
Sequence length 347
Comment homoserine dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MTEYKIALVGFGGVNRALAQLIAERNARWQQELGFGLKIVGVTDLFLGSAIDRNGLDAAT
LAALPAQKGALAQIPQGSAEAFNESVIKQSGADIIAEATFTNPKDGEPAATFCRWALEAG
KHVVTTNKGPIALHAAALKALAKANGVSFEYEGAVMSGTPVLRMARQTLAGAGLVGFEGI
LNGTSNYVLTRMEEGLGFADAVAQAQALGYAEADPSADVEGYDVRLKVVILANELLGACL
QVSDVTCSGISSLDSAAIQQAQAAGQRWKLIGSASRETDGSVRASVEARLLPGNHPLAGI
SGATNAVAFNTELLGAVTVSGPGAGRVETAFALLSDIVAIHTAGRSA
Download sequence
Identical sequences A0A059UVA1 A0A0B5KNL0 A0A0C1I3V4 F8FRX0 V7D0W0 V9UX33
gi|339485599|ref|YP_004700127.1| WP_013970806.1.23948 WP_013970806.1.28354 WP_013970806.1.35335 WP_013970806.1.56258 WP_013970806.1.7435 WP_013970806.1.80759 gi|568185638|ref|YP_008958156.1| gi|568180204|ref|YP_008952723.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]