SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180245|ref|YP_008952764.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568180245|ref|YP_008952764.1|
Domain Number - Region: 246-306
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0718
Family Phosphoglucomutase, first 3 domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568180245|ref|YP_008952764.1|
Sequence length 405
Comment hypothetical protein X969_01950 [Pseudomonas monteilii SB3078]
Sequence
MHPQRTALHNELHARPSLYFDGPAHVFHLALLGGDAACAALLQRCCPDALDTAAAQGITR
LDGHPFKWERHTEFFTLTLVVPCTAADTEWQTLPPVLAEAIAPQAAQVINAVQVLVRDEH
ELDLPHYGFKDPCGSCVGGGDAVVWSDFRLTEDGTNRFRFINRRLNAYRQGRMIRRLLEI
ETYRMMASLTLTTAKDLSQELDAFDKTLVNLSERSAGVDDHDSKGLLEAIAHLSRQVVSR
TVKTRHRFGATQAYAQLVFERLGELRESHVGDCQRLGVFIERRFKPTVRYCAATEQRLEQ
LAKNVANLGDLLQARVQVEMEEQNAEILRSLNARADAQVKIQRAVEGLSIIAITYYLLNL
FKLLYGGLNVLGLGLTARDGLLAMAPPVLLVLLVILLRIRQAKQH
Download sequence
Identical sequences V9UU61
gi|568185679|ref|YP_008958197.1| gi|568180245|ref|YP_008952764.1| WP_024086245.1.23948 WP_024086245.1.28354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]