SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180275|ref|YP_008952795.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180275|ref|YP_008952795.1|
Domain Number 1 Region: 4-191
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.44e-67
Family Peptidyl-tRNA hydrolase-like 0.000000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180275|ref|YP_008952795.1|
Sequence length 194
Comment peptidyl-tRNA hydrolase [Pseudomonas monteilii SB3078]
Sequence
MTAIQLIVGLGNPGPEYEQTRHNAGALFVERIASAQRVSLTADRKYFGLTAKFSHQGNDV
RLLIPTTYMNRSGQSVAALANFFRIKPEAILVAHDELDLPPGVAKLKRGGGHGGHNGLRD
IIAQLGNQNDFHRLRLGIGHPGDAKLVSNFVLGRAPRAEQEKLDASIDFALGVLPDVLAG
DFAKAMRELHSQKA
Download sequence
Identical sequences A0A059URP1 A0A084CC99 A0A099E581 A0A099MVC7 A0A0C1K7Y8 A0A0M2UDS0 A0A136QK55 A0A1L5PJP2 A0A1X7FSV6 A0A285ZA53 B1JEQ3 F8FT54 J3DVU5 L0FET3 V7D9Z1 V9USN8 V9WST2
gi|170723624|ref|YP_001751312.1| gi|431800777|ref|YP_007227680.1| gi|568180275|ref|YP_008952795.1| gi|339485704|ref|YP_004700232.1| WP_008099045.1.15314 WP_008099045.1.1643 WP_008099045.1.23948 WP_008099045.1.25404 WP_008099045.1.28354 WP_008099045.1.32670 WP_008099045.1.33515 WP_008099045.1.35335 WP_008099045.1.35716 WP_008099045.1.36363 WP_008099045.1.41505 WP_008099045.1.42658 WP_008099045.1.52768 WP_008099045.1.56258 WP_008099045.1.57327 WP_008099045.1.57632 WP_008099045.1.59340 WP_008099045.1.61620 WP_008099045.1.65739 WP_008099045.1.66454 WP_008099045.1.71677 WP_008099045.1.7288 WP_008099045.1.7435 WP_008099045.1.75217 WP_008099045.1.75421 WP_008099045.1.76210 WP_008099045.1.76710 WP_008099045.1.76797 WP_008099045.1.78427 WP_008099045.1.80759 WP_008099045.1.83615 WP_008099045.1.92076 WP_008099045.1.92574 WP_008099045.1.9402 WP_008099045.1.95946 WP_008099045.1.98117 WP_008099045.1.99927 gi|568185707|ref|YP_008958226.1| 390235.PputW619_4463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]