SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180292|ref|YP_008952813.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180292|ref|YP_008952813.1|
Domain Number 1 Region: 29-154
Classification Level Classification E-value
Superfamily OMPA-like 0.0000167
Family Outer membrane protein 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568180292|ref|YP_008952813.1|
Sequence length 172
Comment lipid A 3-O-deacylase [Pseudomonas monteilii SB3078]
Sequence
MKKLLGLAAAAVFTLGHSLSAQATDVSFSVGQTGDSTMVYRLGLQSNWEASWWQTSVGRL
TGYWDGAYTYWDGDETASNHSLSFAPVFVYEFAGESVKPYIEAGIGVAAFSSTELEDNEL
GSAFQFEDRIGFGLRFAGGHEIGVRAIHYSNAGIKQPNDGVESYSLHYRMAL
Download sequence
Identical sequences A0A059UVJ8 A0A0B5KH11 V9UU98
gi|568185724|ref|YP_008958244.1| gi|568180292|ref|YP_008952813.1| WP_024086263.1.23948 WP_024086263.1.28354 WP_024086263.1.35335 WP_024086263.1.56258 WP_024086263.1.65739 WP_024086263.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]